epsP

Probable low molecular weight protein-tyrosine-phosphatase EpsP

145 amino acids

May be involved in assembly or function of the EPS I polymerization/export complex and/or the EpsB ATPase. Alternatively it may function in the removal of the terminal phosphate from C55-isoprenyl pyrophosphate in order to recycle the C55-isoprenyl phosphate lipid carrier used in the synthesis of polysaccharide repeat units.

Belongs to the low molecular weight phosphotyrosine protein phosphatase family.

15.711 kDa

MIKTILVVCIGNICRSPMAQALLRQALPGVSVISAGIGALSGYPADPSAVEVMAQHGIDISEHRAQQLTGSLVNRADLILVMGGAQKREIQARHPSKTGSVFRLGEMEQFDIDDPYRKQMMAFEDALAMIQRGVDAWVPRIRALG

epsP

Probable low molecular weight protein-tyrosine-phosphatase EpsP

145 amino acids

May be involved in assembly or function of the EPS I polymerization/export complex and/or the EpsB ATPase. Alternatively it may function in the removal of the terminal phosphate from C55-isoprenyl pyrophosphate in order to recycle the C55-isoprenyl phosphate lipid carrier used in the synthesis of polysaccharide repeat units (By similarity).

Belongs to the low molecular weight phosphotyrosine protein phosphatase family.

15.719 kDa

MIKTILVVCIGNICRSPMAQALLRQSLPGVSVISAGIGALSGYPADPSAVEVMAHHGIDISEHRAQQLTGSLVSRADLILVMDGAQKQEIQSRHPAKTGSVFRLGEMEQFDIADPYRKQLTAFEEALEMIQRGVDAWVPRIRALG