Protein expression services for epsP | Probable low molecular weight protein-tyrosine-phosphatase EpsP
Description
May be involved in assembly or function of the EPS I polymerization/export complex and/or the EpsB ATPase. Alternatively it may function in the removal of the terminal phosphate from C55-isoprenyl pyrophosphate in order to recycle the C55-isoprenyl phosphate lipid carrier used in the synthesis of polysaccharide repeat units.
Family
Belongs to the low molecular weight phosphotyrosine protein phosphatase family.
Species
Ralstonia solanacearum
Length
145 amino acids
Sequence
MIKTILVVCIGNICRSPMAQALLRQALPGVSVISAGIGALSGYPADPSAVEVMAQHGIDISEHRAQQLTGSLVNRADLILVMGGAQKREIQARHPSKTGSVFRLGEMEQFDIDDPYRKQMMAFEDALAMIQRGVDAWVPRIRALG
Mass
15.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make epsP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here