elfD

Probable fimbrial chaperone protein ElfD

233 amino acids

Part of the elfADCG fimbrial operon, which could be required for adherence to host epithelial cells. Could be required for the biogenesis of the ElfA fimbriae.

Belongs to the periplasmic pilus chaperone family.

25.42 kDa

MKTCITKGIVTVSLTAILLSCSSTWAAGKGGVGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKREEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITLTDLKIGGKLVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS

elfD

Probable fimbrial chaperone protein ElfD

233 amino acids

Part of the elfADCG-ycbUVF fimbrial operon, which promotes adhesion of bacteria to different abiotic surfaces. Could be required for the biogenesis of the ElfA fimbriae.

Belongs to the periplasmic pilus chaperone family.

25.389 kDa

MKTCITKGIVTVSLTAILLSCSSAWAAGKGGIGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKRKEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITLTDLKIGGKVVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS

elfD

Probable fimbrial chaperone protein ElfD

233 amino acids

Part of the elfADCG fimbrial operon, which could be required for adherence to host epithelial cells. Could be required for the biogenesis of the ElfA fimbriae.

Belongs to the periplasmic pilus chaperone family.

25.42 kDa

MKTCITKGIVTVSLTAILLSCSSTWAAGKGGVGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKREEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITLTDLKIGGKLVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS

elfD

Probable fimbrial chaperone protein ElfD

233 amino acids

Part of the elfADCG-ycbUVF fimbrial operon, which promotes adhesion of bacteria to different abiotic surfaces. Could be required for the biogenesis of the ElfA fimbriae.

Belongs to the periplasmic pilus chaperone family.

25.389 kDa

MKTCITKGIVTVSLTAILLSCSSAWAAGKGGIGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKRKEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITLTDLKIGGKVVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS