Part of the elfADCG fimbrial operon, which could be required for adherence to host epithelial cells. Could be required for the biogenesis of the ElfA fimbriae.

Belongs to the periplasmic pilus chaperone family.

233 amino acids

MKTCITKGIVTVSLTAILLSCSSTWAAGKGGVGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKREEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITLTDLKIGGKLVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS

25.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make elfD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here