cowN

N(2)-fixation sustaining protein CowN

122 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

14.006 kDa

MRASPTPWLSRAEPYCQRESPMNLLTTTPAGDRYVTFNGIDFEGNMARVLAHLRRYIDDPRTGNAFWDRFKARLAAAESGGNAFQDKLLLLHSHVYYMGDLFEDQEDEAALADLRKLEEECF

cowN

N(2)-fixation sustaining protein CowN

113 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

13.237 kDa

MNAPDPRDQLARPLNNPFAEALDKPDRYVSFCGIDCDGNARILMQHIRRHIDDPTKGNAFWDKFRDKLEGRSSERCDELFLVHSYINMIRELFETYEDDDALALLQKIEEECC

cowN

N(2)-fixation sustaining protein CowN

113 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

13.237 kDa

MNAPDPRDQLARPLNNPFAEALDKPDRYVSFCGIDCDGNARILMQHIRRHIDDPTKGNAFWDKFRDKLEGRSSERCDELFLVHSYINMIRELFETYEDDDALALLQKIEEECC

cowN

N(2)-fixation sustaining protein CowN

113 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

13.189 kDa

MSSIFINKGVEMMESEKSGGMDRYVTFERIDCFKNAHEVVSNALRVLEANPEMKNPFWEKFCSKIPDSFYSYTPQEDLLYLVCANVFYLEELFDEAEDEEGQAIMSRCEFECC

cowN

N(2)-fixation sustaining protein CowN

109 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

12.638 kDa

MDQPAAGFPALHFELEQPDRYLTFQGIDFEGNMRRVLAHLYRYIDDPAHGNAFWDRFKARLQAAEAGAATICDKLLLLHSHVYYMVDLFEEQEDEIALADLKTLEEECF

cowN

N(2)-fixation sustaining protein CowN

106 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

12.374 kDa

MCNCKKNIKVDESYVSFKDIDCFENACLVIDNLLRILKEPKNTNAYWEKFIEKIPEAYYTRDSKKDPSEALLYLVCSCTSNIMELFEEIDDEEAIDAMSKCEQECC

cowN

N(2)-fixation sustaining protein CowN

106 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

12.374 kDa

MCNCKKNIKVDESYVSFKDIDCFENACLVIDNLLRILKEPKNTNAYWEKFIEKIPEAYYTRDSKKDPSEALLYLVCSCTSNIMELFEEIDDEEAIDAMSKCEQECC

cowN

N(2)-fixation sustaining protein CowN

105 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

12.103 kDa

MPCSCKQKKATPSDITTDRYITFDGIDCDGNARILMSYIHKHIDDPQKTNKFWDYFRKKAEGGNGPKPDDLFLIHSNLNQIRELFELYEDSEALALLDVVEIECC

cowN

N(2)-fixation sustaining protein CowN

104 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

12.313 kDa

MSNFEIRVNESYESFKNIDCFENACVVIDNMLRVLENPKNMNIYWKKIVPMIPKAYYDRDPKSDTKEELLYLVCSNSFYLDELFEKAEDEQAINALSKCEQECC

cowN

N(2)-fixation sustaining protein CowN

101 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.909 kDa

MQKMTETDRYVTFKGIDGDGNARRLVAMLRRHIDDPAKTNLFWEKFKEKLELAESPDTNNTRRLDELFLIHSYINNIYDLLEEHGDQEALTLLHQIEVESC

cowN

N(2)-fixation sustaining protein CowN

101 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO. Is not required for CO-dependent growth.

Belongs to the CowN family.

11.357 kDa

MTMDGPAHMPRRYVTFQGVNVEGLSQQLIARILFHVADPAKSNAFWEHFKAKLADADKTLARTADSLCLLCGAIGYIDELFEDNDDEEGLTILRRLEDELC

cowN

N(2)-fixation sustaining protein CowN

101 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.909 kDa

MQKMTETDRYVTFKGIDGDGNARRLVAMLRRHIDDPAKTNLFWEKFKEKLELAESPDTNNTRRLDELFLIHSYINNIYDLLEEHGDQEALTLLHQIEVESC

cowN

N(2)-fixation sustaining protein CowN

101 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO. Is not required for CO-dependent growth.

Belongs to the CowN family.

11.357 kDa

MTMDGPAHMPRRYVTFQGVNVEGLSQQLIARILFHVADPAKSNAFWEHFKAKLADADKTLARTADSLCLLCGAIGYIDELFEDNDDEEGLTILRRLEDELC

cowN

N(2)-fixation sustaining protein CowN

99 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.227 kDa

MNTPAARPDRYQSFAHIPCDAMALKLLTHLEQLLQAEDTLEPFWQLFLQKAAIAKQPQPGQADALKLICSNSYYIFDLFAAQQDQAGEAMMDELEYQCC

cowN

N(2)-fixation sustaining protein CowN

99 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.227 kDa

MNTPAARPDRYQSFAHIPCDAMALKLLTHLEQLLQAEDTLEPFWQLFLQKAAIAKQPQPGQADALKLICSNSYYIFDLFAAQQDQAGEAMMDELEYQCC

cowN

N(2)-fixation sustaining protein CowN

98 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.425 kDa

MPQDCACRKTDRYVSFQDIDCTGNARRLMEHLDRQLSIPGRSTAFWEYFAKKRAGSAAAKPDDLFLIHSNINQFREFFEQWNDSDALSLLLQIEEECC

cowN

N(2)-fixation sustaining protein CowN

98 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.449 kDa

MSKPDRYVSFVGIDGDSNARKLVALLRRHIDDPARTNRFWELFKDKLEKINKPDETSGFSQDELYLVHAYINNIRELFETYDDQPALALLDRIEAESC

cowN

N(2)-fixation sustaining protein CowN

98 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.907 kDa

MTATTQADRYISFSGIDCDGNAKIVLERVVALVALPEYANCFWDRFLIRLAEADKVGARKADELCLACSNTYYIEELFEAAGDEMGLAALRRLEDECC

cowN

N(2)-fixation sustaining protein CowN

98 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.425 kDa

MPQDCACRKTDRYVSFQDIDCTGNARRLMEHLDRQLSIPGRSTAFWEYFAKKRAGSAAAKPDDLFLIHSNINQFREFFEQWNDSDALSLLLQIEEECC

cowN

N(2)-fixation sustaining protein CowN

98 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.449 kDa

MSKPDRYVSFVGIDGDSNARKLVALLRRHIDDPARTNRFWELFKDKLEKINKPDETSGFSQDELYLVHAYINNIRELFETYDDQPALALLDRIEAESC

cowN

N(2)-fixation sustaining protein CowN

98 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.907 kDa

MTATTQADRYISFSGIDCDGNAKIVLERVVALVALPEYANCFWDRFLIRLAEADKVGARKADELCLACSNTYYIEELFEAAGDEMGLAALRRLEDECC

cowN

N(2)-fixation sustaining protein CowN

98 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.371 kDa

MDSFDAPDRYVSFKGIDCEGNSRRIIDRLHMHIDDPAKTNAFWERFRAKLAIAEDPLKRQADGLCLLCANIYYIADLFEEHDDEDGLAMLRQLEDECC

cowN

N(2)-fixation sustaining protein CowN

97 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.165 kDa

MSTTTYRSICGEESLPYIDCDRCIRALYARLQHYVQQDRGDCPICAYFREKIGSRDGSESDARLLLHAQVNVVYELFARHADQEALALLERIEDDCC

cowN

N(2)-fixation sustaining protein CowN

97 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.165 kDa

MSTTTYRSICGEESLPYIDCDRCIRALYARLQHYVQQDRGDCPICAYFREKIGSRDGSESDARLLLHAQVNVVYELFARHADQEALALLERIEDDCC

cowN

N(2)-fixation sustaining protein CowN

95 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.056 kDa

MSQAAVKIDRYITFEGIECDEQARRVLDCIRDCIEAPEASSWSAYFERKLDEITRMGQDELFVVGSQVNYIRALFEHHGHREGLDLLDRIEDECC

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.582 kDa

MNDQTPDRYVTFMGIACDTNADRLCEMLAARMAGNDSRWVAYFEKKLAENAQMGHDRLRFIGAQVNALMSFFEEEDDEAALALLWHIEHHCL

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.932 kDa

MSGSFDRYVSFKNSNWEVRSERVMARLQKHIDAAENPFWAYFAQKRIELREKQGLDDLRVLHNYLPTLRELLEDNGDLETLAMLEELEVTLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.836 kDa

MTAAFDRYVSFKNADWEGKSQRVMERLQIHIDAAQNPFWAYFAQKRTELNQKQGLDDLRVLHNYLPTLREILEDNGDQETLAMLEDLEVTCM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.016 kDa

MSASFDRYVSFQHCDWEGRSERVMQRLQRHVEAAENPFWAYFAQKRAELRDKQGLDDLRILHNYLPTLRELLEDNGDLETLEMLEDLEANLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.739 kDa

MNVPFDRYVSFKNADWEGKSQRVMAKLQSHIDAADNPFWGYFAKKRTELNEKQGLDDLRVLHNYLPTLREILEESGDDETLAMLEDLEVTCM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.977 kDa

MSGSFDRYVSFKNCDWKVRSERVMARLQRHIDAAENPFWAYFAQKRTELREKQGLDDLRVLHNYLPTLRELLEDNGDLETLAMLEELEVNLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.016 kDa

MSASFDRYVSFQHCDWEGRSERVMQRLQRHVEAAENPFWAYFAQKRAELRDKQGLDDLRILHNYLPTLRELLEDNGDLETLEMLEDLEANLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.582 kDa

MNDQTPDRYVTFMGIACDTNADRLCEMLAARMAGNDSRWVAYFEKKLAENAQMGHDRLRFIGAQVNALMSFFEEEDDEAALALLWHIEHHCL

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.932 kDa

MSGSFDRYVSFKNSNWEVRSERVMARLQKHIDAAENPFWAYFAQKRIELREKQGLDDLRVLHNYLPTLRELLEDNGDLETLAMLEELEVTLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.836 kDa

MTAAFDRYVSFKNADWEGKSQRVMERLQIHIDAAQNPFWAYFAQKRTELNQKQGLDDLRVLHNYLPTLREILEDNGDQETLAMLEDLEVTCM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.016 kDa

MSASFDRYVSFQHCDWEGRSERVMQRLQRHVEAAENPFWAYFAQKRAELRDKQGLDDLRILHNYLPTLRELLEDNGDLETLEMLEDLEANLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.739 kDa

MNVPFDRYVSFKNADWEGKSQRVMAKLQSHIDAADNPFWGYFAKKRTELNEKQGLDDLRVLHNYLPTLREILEESGDDETLAMLEDLEVTCM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.977 kDa

MSGSFDRYVSFKNCDWKVRSERVMARLQRHIDAAENPFWAYFAQKRTELREKQGLDDLRVLHNYLPTLRELLEDNGDLETLAMLEELEVNLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

11.016 kDa

MSASFDRYVSFQHCDWEGRSERVMQRLQRHVEAAENPFWAYFAQKRAELRDKQGLDDLRILHNYLPTLRELLEDNGDLETLEMLEDLEANLM

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.722 kDa

MNDHTPDRYVTFLGIDCDAKADRMMEMLSARLASTDSPWVRYFEQKLAEKARMATDNLHFVGSQINSLYSFFEEAEDEEGLDLLWHLEHNCC

cowN

N(2)-fixation sustaining protein CowN

92 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.851 kDa

MNDQTPDRYVTFLGLDCDAKADRLMDMLAVRIQEDDSRWVGYFRQKLAEKERMATDNLHFVGSQINSLYSYFEELEDADALDLLWHLEHNCC

cowN

N(2)-fixation sustaining protein CowN

91 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.739 kDa

MTAQVDRYVSFKGIDWVGRSREIFARLQSHIDQANSPFWPYFTRQRKLAHSQGLDDLRVLHNYLPTLRELLENMGDLKTLGMLEELEQICM

cowN

N(2)-fixation sustaining protein CowN

91 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.925 kDa

MTEQIDRYVSFRNVEWERRTAEVFALLQPHFDGSTSPFWDYFLRQRVIAHAQGLDDLRVLHNFLPTLKDLLEELDDERTLSRLEELEVLCM

cowN

N(2)-fixation sustaining protein CowN

91 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.739 kDa

MTAQVDRYVSFKGIDWVGRSREIFARLQSHIDQANSPFWPYFTRQRKLAHSQGLDDLRVLHNYLPTLRELLENMGDLKTLGMLEELEQICM

cowN

N(2)-fixation sustaining protein CowN

91 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.925 kDa

MTEQIDRYVSFRNVEWERRTAEVFALLQPHFDGSTSPFWDYFLRQRVIAHAQGLDDLRVLHNFLPTLKDLLEELDDERTLSRLEELEVLCM

cowN

N(2)-fixation sustaining protein CowN

90 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.322 kDa

MATADHEATGLDCDHAIRRLLRRIDAHIADEPRDSPVRRYLERELGGREGTEADTRLVVHAQINVVRELFERRSDADGLRLLSNIERECC

cowN

N(2)-fixation sustaining protein CowN

90 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.585 kDa

MGKYDRYISFKNANWESQSSGVMDGLKPHIEAADSPFWVYFMRQRELAHQRGLDDLRVLHNFLPTLRELLEELDDQPTLALLEQLEESCM

cowN

N(2)-fixation sustaining protein CowN

90 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.322 kDa

MATADHEATGLDCDHAIRRLLRRIDAHIADEPRDSPVRRYLERELGGREGTEADTRLVVHAQINVVRELFERRSDADGLRLLSNIERECC

cowN

N(2)-fixation sustaining protein CowN

90 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.585 kDa

MGKYDRYISFKNANWESQSSGVMDGLKPHIEAADSPFWVYFMRQRELAHQRGLDDLRVLHNFLPTLRELLEELDDQPTLALLEQLEESCM

cowN

N(2)-fixation sustaining protein CowN

88 amino acids

Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

10.403 kDa

MSEQIDRYVSFKNIDCNARAGQMMDALQPYIQAAENPFWAYFQQKRAEFNAKGYDDLRVLHNYLPTLKELIEDDELLAQLEDLEYTCM