Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO.

Belongs to the CowN family.

90 amino acids

MATADHEATGLDCDHAIRRLLRRIDAHIADEPRDSPVRRYLERELGGREGTEADTRLVVHAQINVVRELFERRSDADGLRLLSNIERECC

10.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cowN using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here