cntB

Carnitine monooxygenase reductase subunit

318 amino acids

Converts carnitine to trimethylamine and malic semialdehyde.

Belongs to the PDR/VanB family. CntB subfamily.

35.538 kDa

MASHYEMFPAVVTRVEQLTPLIKRFTFKRQDGQNFPRFSGGSHIIVKMNEQLSNAYSLMSCTQDLSTYQVCVRKDVEGKGGSVFMHDQCNEGCEIQISEPKNLFPLAETGNKHILIAGGIGITPFLPQMDELAARGAEYELHYAYRSPEHAALLDELTQKHAGHVFSYVDSEGSMLNLDELISSQPKGTHVYVCGPKPMIDAVIDCCNKHRYRDEYIHWEQFASTVPEDGEAFTVVLAKSNQEIEVQSNQTILQAIETLNIDVECLCREGVCGTCETAILEGEAEHFDQYLSDAEKASQKSMMICVSRAKGKKLVLDL

cntB

Metal-staphylopine import system permease protein CntB

311 amino acids

Part of the ABC transporter complex CntABCDF (Opp1) involved in the uptake of metal in complex with the metallophore staphylopine (StP). Involved in the import of divalent metals ions such as nickel, cobalt and zinc. Probably responsible for the translocation of the substrate across the membrane (PubMed:23279021, PubMed:29581261). Plays a major role in nickel/cobalt import in zinc-depleted conditions. Contributes to virulence. Required for full urease activity in vitro (PubMed:23279021).

Belongs to the binding-protein-dependent transport system permease family.

34.781 kDa

MFKFILKRIALMFPLMIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYGFNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIILGVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILPVIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNALQVAVSIFCMSIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINALLNPRLREGAR

cntB

Metal-staphylopine import system permease protein CntB

311 amino acids

Part of the ABC transporter complex CntABCDF (Opp1) involved in the uptake of metal in complex with the metallophore staphylopine (StP). May be involved in the import of a large array of divalent metals ions such as nickel, cobalt, zinc, copper and iron. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the binding-protein-dependent transport system permease family.

34.749 kDa

MFKFILKRIALMFPLVIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYGFNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIILGVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILPVIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNAIQVAVSIFCMSIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINALLNPRLREGAR