Part of the ABC transporter complex CntABCDF (Opp1) involved in the uptake of metal in complex with the metallophore staphylopine (StP). May be involved in the import of a large array of divalent metals ions such as nickel, cobalt, zinc, copper and iron. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the binding-protein-dependent transport system permease family.

311 amino acids

MFKFILKRIALMFPLVIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYGFNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIILGVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILPVIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNAIQVAVSIFCMSIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINALLNPRLREGAR

34.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cntB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here