CmaA

L-allo-isoleucine:holo-[CmaA peptidyl-carrier protein] ligase

595 amino acids

Involved in the biosynthesis of the phytotoxin coronatine (COR) which mimics the plant hormone jasmonic acid isoleucine and promotes opening of stomata for bacterial entry, bacterial growth in the apoplast, systemic susceptibility, and disease symptoms. CmaA catalyzes the adenylation of L-allo-isoleucine (via the A domain) and the attachment of L-allo-isoleucine to the 4'-phosphopantetheine arm located within the T domain of CmaA. It can also use L-isoleucine, L-leucine and L-valine as substerates.

Belongs to the ATP-dependent AMP-binding enzyme family.

65.93 kDa

MTSYHSHPPKAYRRFESVCTQAPNAIAVVHEGKPVTYQQLQTQVLERSEALIRQGLADHPYMPLMANRCLEYLITMLACCKLGITYVSIEPSTPSKRLIAVLEQLGCNHLLLLGQPTDLRPDPTLTCFRLDDCGTLCSDGPALRQPIRRRLDDASVITVMFTSGTTGVPKGVRISQDGLLNLVDNVQQQVQGKPRSYVHHSSIGFDAALFEVWVPLLTGACVTLQPSEFNIDALDHCVRAASCDVLLLTTSLFHLVAQHRLSMLEAVRVLYVGGEVLKPVHARALLLANPRITLVNGYGPTENTVFSTWYSLNKPEDAERDVIPIGQFLHQVHGKIVDAKLQEVEVGTPGELLLTGANLALGYLDEALTPTRFLQLPEGTYYRTGDYVIQDEHGMLFYQGRIDEQVKIKGFRVEIAEVEHALTQLPGVAQAVVQAHVMNDLENSLHAFIVFRHGSPTIEESKLMSLLGDRLPHYMVPRRIHYLAELPLTANGKVDKRSLQPPEKAAVVSPQAGSAVLEIWSGILGTRNLQLEHSIYGYGASSLSVVMAHSRINEILGRTTPFDEVARLSTFQEWVQYYATHADPVTSLRSQHGNH

cmaA

Hydroxymycolate synthase MmaA4

301 amino acids

Involved in the biosynthesis of hydroxymycolate, a common precursor of oxygenated mycolic acids (methoxymycolate and ketomycolate). Probably transfers a methyl group from the S-adenosylmethionine (SAM) cofactor and, subsequently or simultaneously, a water molecule onto the double bound of ethylene substrates, leading to the formation of the hydroxylated product at the distal position.

Belongs to the CFA/CMAS family.

34.636 kDa

MTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERLDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA