clpP

ATP-dependent Clp protease proteolytic subunit

1010 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity).

Belongs to the peptidase S14 family.

114.552 kDa

MPIGVPRIIYCWGEELPAQWTDIYNFIFRRRMVFLMQYLDDELCNQICGLLINIHMEDRSKELEKKEIERSGLFKGGPKTQKGGTGAGETGASSIQNKKSNSSSFEDLLAADEDLGIDENNTLEQYTLQKITMEWLNWNAQFFDYSDEPYLFYLAEMLSKDFNKGDARMLFSNNNKFSMPFSQMLNTGSMSDPRRPQSTNGANWNSSEQNNSLDIYSPFRMLANFEAQDYDFKQINPSLASKEEVFKLFNNTILKNGGQRNNNMSKLLTELAQRNWENKTNSQENLYKSTEKALSQRNLRKEYIKDRTLNNYSSDPFNTKGYVNAQGASTGPSPRTRGMHADGSLNYLDFYSYNDSYNDFKTAPRGKQAERAFQEEESKKVFVIINSFGGSVGNGITVHDALQFIKAGSLTLALGVAASAASLALAGGTIGERYVTEGCHVMIHQPECLTSDHTVLTTRGWIPIADVTLDDKVAVLDNNTGEMSYQNPQKVHKYDYEGPMYEVKTAGVDLFVTPNHRMYVNTTNNTTNQNYNLVEASSIFGKKVRYKNDAIWNKTDYQFILPETATLTGHTNKISSTPAIQPEMNAWLTFFGLWIANGHTTKIAEKTAENNQQKQRYKVILTQVKEDVCDIIEQTLNKLGFNFIRSGKDYTIENKQLWSYLNPFDNGALNKYLPDWVWELSSQQCKILLNSLCLGNCLFTKNDDTLHYFSTSERFANDVSRLALHAGTTSTIQLEAAPSNLYDTIIGLPVEVNTTLWRVIINQSSFYSYSTDKSSALNLSNNVACYVNAQSALTLEQNSQKINKNTLVLTKNNVKSQTMHSQRAERVDTALLTQKELDNSLNHEILINKNPGTSQLECVVNPEVNNTSTNDRFVYYKGPVYCLTGPNNVFYVQRNGKAVWTGNSSIQGQASDIWIDSQEIMKIRLDVAEIYSLATYRPRHKILRDLDRDFYLTATETIHYGLADEIASNEVMQEIIEMTSKVWDYHDTKQQRLLESRDSTTSGADTQSQN

clpP

ATP-dependent Clp protease proteolytic subunit

524 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity).

Belongs to the peptidase S14 family.

59.501 kDa

MPIGVPRIIYCWGEELPAQWTDIYNFIFRRRMVFLMQYLDDELCNQICGLLINIHMEDRSKELEKKEMEKSGLFKSGTAKTKGKDTVKKENLSGGASAKRQSVEDLLTSDNDFGIEENHLLEQYTLQKITTEWLNWNAQFFDYSDEPYLYYLADILSKDFSPNQDKDSANLNFAKSSANKQAFQNPAEMTKLIKNLKNLKNFSTGSKNVKQNLDVYSPFRLLANFAPQNYNLEHPNQNLAEIYSLLKTSTQNTNQPFTKKLIDNLSHKELMNRLQSPEKLVASSEKALGRRRLKQRYVQERLGSGGLSNSKALKAYNYLDQGALNNESGRSLYRKQTERVIQEEESKKVFMIINSFGGSVGNGITVHDALQFIKAGSLTLALGVAASAASLALAGGTIGERYVTEGCHTMIHQPEGGLNGQASDIWIDSQEIMKIRLDVAEIYSLSTYRPRHKILRDLDRDFYLTAMETIYYGLADEIATNEVMHSIVEMTNQVWSYHDSKQERLLESRASLVGDSTQTQESNS

CLPP

ATP-dependent Clp protease proteolytic subunit, mitochondrial

277 amino acids

Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.

Belongs to the peptidase S14 family.

30.18 kDa

MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

CLPP

ATP-dependent Clp protease proteolytic subunit, mitochondrial

272 amino acids

Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates (By similarity).

Belongs to the peptidase S14 family.

29.704 kDa

MWPKILLRGGRVAAGLCPALGPRLAARFPPQRTPENRLAPQRNLHATAARALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTSGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYSIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPELVQKEPGEPTAVEPAPASA

Clpp

ATP-dependent Clp protease proteolytic subunit, mitochondrial

272 amino acids

Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates (By similarity).

Belongs to the peptidase S14 family.

29.8 kDa

MWPRVLLGEARVAVDGCRALLSRLAVHFSPPWTAVSCSPLRRSLHGTATRAFPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGSPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPELVQKETATAPTDPPAPTST

clpP

ATP-dependent Clp protease proteolytic subunit

249 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

27.956 kDa

MPIGMPKIPFLLDGDEEDEEEDDATWVDLYNVLYRTRSIFLGDAIHFEVANHIAGLMIFLTIQDATQNLYFFINSPGGLAVAGLLIYDTMQYVTPPVYTLGLGVLASMASFLLVGGETSKRLMGPNGRVMIHQPESDYTHKDQSLEVQLDSGEVEDIRKMVIRVYLERTRLPREVLNDHLERNYFMTATEAKYYGIVDDIGIQNLLARLRAESASQDNSLDPDAPDESASQDNSLDPDAPDETRPPKLR

clpP

ATP-dependent Clp protease proteolytic subunit

249 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

27.956 kDa

MPIGMPKIPFLLDGDEEDEEEDDATWVDLYNVLYRTRSIFLGDAIHFEVANHIAGLMIFLTIQDATQNLYFFINSPGGLAVAGLLIYDTMQYVTPPVYTLGLGVLASMASFLLVGGETSKRLMGPNGRVMIHQPESDYTHKDQSLEVQLDSGEVEDIRKMVIRVYLERTRLPREVLNDHLERNYFMTATEAKYYGIVDDIGIQNLLARLRAESASQDNSLDPDAPDESASQDNSLDPDAPDETRPPKLR

clpP

ATP-dependent Clp protease proteolytic subunit

235 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.472 kDa

MLDLFGASSAPTFGNQGKFTTDPVTGALIPVVVEQSSRGERSFDIYSRLLRERIIFVTGEVEDHMASVIIAQLLFLESENPSKDISMYINSPGGVVTAGLAIYDTMQYIRPRVSTVCIGQAASMGSFLLAAGEPGMRIALPNARIMIHQPSGGARGMASDIEIQAREILRIRKRMNDLYVKFTGRSLDEIEKAMDRDTFLEAEEAMKFGLVDKVFESRPATDSVGEGEGSGGAPA

clpP

ATP-dependent Clp protease proteolytic subunit

235 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.472 kDa

MLDLFGASSAPTFGNQGKFTTDPVTGALIPVVVEQSSRGERSFDIYSRLLRERIIFVTGEVEDHMASVIIAQLLFLESENPSKDISMYINSPGGVVTAGLAIYDTMQYIRPRVSTVCIGQAASMGSFLLAAGEPGMRIALPNARIMIHQPSGGARGMASDIEIQAREILRIRKRMNDLYVKFTGRSLDEIEKAMDRDTFLEAEEAMKFGLVDKVFESRPATDSVGEGEGSGGAPA

clpP

ATP-dependent Clp protease proteolytic subunit

227 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.808 kDa

MRATPPRDDTYPSNENFKEKYPMSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCGPIEDHMANLITAQLLFLEAENPEKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSFLLCGGEKGMRYSLPHSRVMIHQPSGGYRGQATDIEIHAQETLKIKKILNSLYSKHTGQDVKHVEKSMERDNFMSPEEAKKFGIIDKIITHRDIKLLKDKEQGQ

clpP

ATP-dependent Clp protease proteolytic subunit

227 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.236 kDa

MANINFGFEHHARKLYSGAIEQGITGSLVPMVIETSGRGERAFDIFSRLLRERIIFLGSGIDEHVAGLIMAQLIFLESEDPERDIYIYVNSPGGSVSAGLGIYDTMQYIRPDVSTVCVGMAASMGAFLLASGTKGKRASLPHSRIMIHQPSGGAQGQESDIIIQAREIEKIRRLLEEILASHTGKDVQQVREDSERDRWMNAQEALEYGIIDQIFEKRPKPDKEKES

clpP

ATP-dependent Clp protease proteolytic subunit

225 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.893 kDa

MANINFGFEHHASKLYSGAIEEGIQNSLVPMVIETSGRGERAFDIFSRLLRERIIFLGSGIDEHVAGLIMAQLIFLESEDPDRDIFIYVNSPGGSVSAGLGIYDTMQYIRPDVSTVCVGMAASMGAFLLASGAKGKRASLPHSRIMIHQPSGGAQGQESDIIIQAREIEKIRRLLEEIMAKHTGKDVQQVREDSERDRWMDAGEALEYGIIDQVFEKRPAPEKKD

clpP

ATP-dependent Clp protease proteolytic subunit

225 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.998 kDa

MANINFGFDHHAKKLYSGAIENSINSQLVPMVIETSGRGERAFDIFSRLLRERIIFLGSPIDEHVAGLIIAQLIFLESEDPERDIYIYINSPGGSVSAGLGIYDTMQYIRPDISTVCVGMAASMGAFLLASGTSGKRASLPHSRIMIHQPSGGAQGQETDILIQAREIEKIRHLLEDLLAKHTGQEVSRIREDSERDRWMSAVEAKEYGLIDQIFEKRPAPKSEE

clpP

ATP-dependent Clp protease proteolytic subunit

225 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.228 kDa

MPIGIPKVAYRIPGESVSTYVDVYNRLYRERILFLGEDLDDEVANQLIGVMVFLNSEDDTKGIFFYINSPGGSMNSGLGVYDMIQHINVDVTTICMGLAASMASFILAGGTPGQRLMFPHARVMLHQPMGGNGGKAKYMVEESVEVKRLRELIAHLYAKRTGQPIERIRIDMNRDNFMRPRAAKEYGLIDHMITHITELDELEKDASDLRRFGGVDLTKLNKQGS

clpP

ATP-dependent Clp protease proteolytic subunit

225 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.07 kDa

MANINFGFEHHAKKLYSGAIEQGISNSLVPMVIETSGRGERAFDIFSRLLRERIIFLGTGIDEHVAGLIMAQLIFLESEDPERDIYIYINSPGGSVSAGLGIYDTMQYIRPEISTVCVGMAASMGAFLLASGNKGKRASLPHSRIMIHQPSGGAQGQETDIVIQAREIEKIRRLLEELLAKHTGQPVEKVREDSERDRWMNPQEALEYGLIDAIFEKRPTPEKKD

clpP

ATP-dependent Clp protease proteolytic subunit

225 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.862 kDa

MANINFGFEHHASKLYSGAIEQGIQNSLVPMVIETSGRGERAFDIFSRLLRERIIFLGSGIDEHVAGLIMAQLIFLESEDPERDIYIYVNSPGGSVSAGLGIYDTMQYIRPDVSTVCVGMAASMGAFLLASGAKGKRASLPHSRIMIHQPSGGAQGQESDIIIQAREIEKIRRLLEEILASHTGKDVQQVREDSERDRWMNAEEALDYGIIDQVFAKRPAPEKKD

clpP

ATP-dependent Clp protease proteolytic subunit

225 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.056 kDa

MTDYDRITANPHFDMLMSAHNHVQSTTQSALVPMVVEQSARGERSFDIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEAENPDKDIHLYINSPGGSVSAGLAIFDTMNFIKPEVSTICMGGAYSMGSFLLAAGQKGKRYALANARVMIHQPSGGAQGQATDIEINAREILKTRARLNEILAERTGQSVEKIEKDVERDYWLDAKEAKEYGLIDEVLERRPASL

clpP

ATP-dependent Clp protease proteolytic subunit

222 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.804 kDa

MNEFKKYATRHIGLNAQALDDYTRIQSSYISPTIIEERQLNVAQMDVFSRLMMDRIIFLGTQIDDYTANVIQAQLLYLDSADPGKDISIYLNSPGGSVYAGYGIYDTMQYIGCDVATICTGMAASMASVLLVAGTKGKRFALPHSRVMIHQPLGGMQGQASDLEIAAREILRVKKELYTIISSHSGKPVEQVEKDSDRDYWMTAPEALEYGMIDKILEKNRK

clpP

ATP-dependent Clp protease proteolytic subunit

220 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.422 kDa

MDDFRKYATKHLGMNAMVLDDVIKSQAGYLNPYILEERQLNVTQLDVFSRLMMDRIIFLGTQIDDYTANTLQAQLLYLDSVDPGKDISIYINSPGGSVYAGLGIYDTMQFISSDVATICTGMAASMASVLLVAGAKGKRSALPHSRVMIHQPMGGAQGQASDIEITAREIQKLKKELYTIIADHSGTSFDKVWADSDRDYWMTAQEAKEYGMIDEVLIKK

clpP

ATP-dependent Clp protease proteolytic subunit

220 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.487 kDa

MDDFRKYATKHLGMNGMVLDDVIKSQAGYLNPYILEERQLNVTQLDVFSRLMMDRIIFLGTQVDDYTANTLQAQLLYLDSVDPGKDISIYINSPGGSVYAGLGIYDTMQFISSDVATICTGMAASMAAVLLVAGAEGKRSALPHSRVMIHQPMGGAQGQASDIEITAREIQKLKKELYTIIADHSHTDFDKVWADSDRDYWMTAQEAKEYGMIDEVLIKK

clpP

ATP-dependent Clp protease proteolytic subunit

220 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.225 kDa

MFNSQITSQRSSQVSSQSSATGIESALVPMVVEQTAKGERSYDIYSRLLKERVIFLCGQVEDHMANLIIAQLLFLESESPDKDIYLYINSPGGSVTAGMAIYDTMKFIKPNISTVCIGQAASMGAFLLSGGEKGKRYCLPNARVMIHQPLGGFQGQASDFEIHAKEILFIKDKLNKLMAEHTGQTLDKVSQDTDRDNFLSAEAAVEYGLVDSILEQRNDK

clpP

ATP-dependent Clp protease proteolytic subunit

219 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.543 kDa

MPIGVPKVPFRLPGEEDAVWVDIYNRLYRERLLFLGQRVDDEIANQLIGIMMYLNGEDDSKEMFMYINSPGGSVVAGIAVFDAMQYVGPDVTTICMGMAASMGSFILMGGEMTKRIALPHARVMIHQPASSYYDGQAGECLMEAEEVLKLRDCIAKVYMNRTGQPGWVIYRDMDRDIFMSALEAKSYGIVDLVGEDPTATPSVWFRWPSLLDSKDSNEK

clpP

ATP-dependent Clp protease proteolytic subunit

217 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.775 kDa

MQRFTDFYAAMHGGSSVTPTGLGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLESENPDKDISFYINSPGGSVYAGMAIYDTMQFIKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRIMIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDAVSYGLVDKVLTSRAQT

clpP

ATP-dependent Clp protease proteolytic subunit

217 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.775 kDa

MQRFTDFYAAMHGGSSVTPTGLGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLESENPDKDISFYINSPGGSVYAGMAIYDTMQFIKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRIMIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDAVSYGLVDKVLTSRAQT

clpP

ATP-dependent Clp protease proteolytic subunit

217 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.684 kDa

MQRFTDFYASMHGGASVTPTGLGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLIVAQLLFLESENPDKDISLYINSPGGSVYAGMAIYDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRIMIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDAVSYGLVDKVLASRSEG

clpP

ATP-dependent Clp protease proteolytic subunit

217 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.775 kDa

MQRFTDFYAAMHGGSSVTPTGLGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLESENPDKDISFYINSPGGSVYAGMAIYDTMQFIKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRIMIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDAVSYGLVDKVLTSRAQT

clpP

ATP-dependent Clp protease proteolytic subunit

217 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.756 kDa

MIRNELIDQLARTQASALETQGLGLVPMVVEQSGRGERAYDIYSRLLKERVIFMVGEVNDQTANLVVAQLLFLESENPDKDISLYINSPGGSVSAGLAMYDTMQFVKPDVSTLCMGMAASMGAFLLAAGAKGKRYALPNSRIMIHQPLGGARGQASDIEIQAREILYLRERLNTILSEVTGQPVDKIARDTDRDNFMSGDQAKEYGLIDKVLARRGA

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.671 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGVAASMASFVLIGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITKVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMVDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.728 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMLDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.728 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMLDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.728 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMLDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.728 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMLDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.728 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMLDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.728 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMLDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.743 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYLSIEDGNSDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMIDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.743 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYLSIEDGNSDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMIDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.711 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPAKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMIDKHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.582 kDa

MTRNDLLDRLATTQASALETQGLGLVPMVVEQSGRGERAYDIYSRLLKERVVFMVGEVNDQTANLVVAQLLFLESENPDKDVSLYINSPGGSVSAGLAIYDTMQFIKPDVQTLCMGMAASMGAFLLAAGAKGKRSALPNSRIMIHQPLGGARGQASDIEIQAREILYLRERLNSILSEVTGQPVEKIARDTDRDNFMSGDQAVDYGLIDKVITRRS

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.495 kDa

MTRNDLLDRLATTQASALETQGLGLVPMVVEQSGRGERAYDIYSRLLKERVVFMVGEVNDQTANLVVAQLLFLESENPDKDVSLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGMAASMGAFLLAAGAKGKRSALPNSRIMIHQPLGGARGQASDIEIQAREILYLRERLNTILSEVTGQPVEKIARDTDRDNFMSGDQAVDYGLIDKVLARRG

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.534 kDa

MTRNDLLDRLATTQASALETQGLGLVPMVVEQSGRGERAYDIYSRLLKERVVFLVGEVNDQTANLVVAQLLFLESENPDKDISLYINSPGGSVSAGLAIYDTMQFVKPDVQTLCMGMAASMGAFLLAAGAKGKRSALPNSRIMIHQPLGGARGQASDIEIQAREILYLRERLNSILSEVTGQPVEKIARDTDRDNFMSGDQAVDYGLIDKVIARRS

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.495 kDa

MTRNDLLDRLATTQASALETQGLGLVPMVVEQSGRGERAYDIYSRLLKERVVFMVGEVNDQTANLVVAQLLFLESENPDKDVSLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGMAASMGAFLLAAGAKGKRSALPNSRIMIHQPLGGARGQASDIEIQAREILYLRERLNTILSEVTGQPVEKIARDTDRDNFMSGDQAVDYGLIDKVLARRG

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.728 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYALRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMLDEHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.727 kDa

MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYLSIEDGISDIFLFINSPGGWLISGMAIFDTMQTVTPDIYTICLGIAASMASFILLGGEPTKRIAFPHARIMLHQPASAYYRARTPEFLLEVEELHKVREMITRVYAVRTGKPFWVVSEDMERDVFMSADEAKAYGLVDIVGDEMIDKHCDTDPVWFPEMFKDW

clpP

ATP-dependent Clp protease proteolytic subunit

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.915 kDa

MIDRDPIDVFNNTLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGQVHDGVASLICAQLLFLESENPSKDISFYINSPGGVVTSGMAIYDTMQYIRSPVSTVCIGQAASMGSLLLCAGEAGKRYATPNARIMIHQPSGGFQGQAADIEIQAREILALRERLNRIYVKHTGQPLETIERAMDRDNYMTAEESRAFGLTDSVIERRALSDDGDTKSSS

clpP

ATP-dependent Clp protease proteolytic subunit

215 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.259 kDa

MSSFDEQNTRLPSMTLVPMVVEQTSRGERAYDIYSRMLKERVIFLTGQVEEHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFITPDVSTICIGQACSMGAFLLAAGAKSKRYCLPNARVMIHQPLGGFQGQASDIEIHAKEILKVKKRMNDLMAIHTKKTLKIIEKDTERDHFLSAEEAKKYGLVDCVLTERKDVKNFSKK

clpP

ATP-dependent Clp protease proteolytic subunit

215 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.763 kDa

MLGAVGPGALWGFEREIMNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENPEKDISLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALPNSRIMVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMVAEKAKDFGIVDKVIDKRGGEQI

clpP

ATP-dependent Clp protease proteolytic subunit

215 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.763 kDa

MLGAVGPGALWGFEREIMNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENPEKDISLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALPNSRIMVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMVAEKAKDFGIVDKVIDKRGGEQI

clpP

ATP-dependent Clp protease proteolytic subunit

215 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.699 kDa

MSAHTTAQSAQYNQSATQAALVPMVVEQSARGERSFDIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEAENPDKDIHLYINSPGGSVSAGLAIFDTMNFIKPEVSTICMGGAYSMGSFLLAAGEKGKRYALANARVMIHQPSGGAQGQATDIEINAREILKTRARLNEILAERTGQPVDKIEKDVERDYWLDAKEAKEYGLIDEVLERRPASL

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.443 kDa

MQPILDWEKNELNTTGLGLIPMVIESSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLESENSEKDISLYINSPGGLVTAGLAVYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKGKRYCLPNSRVMIHQPLGGFQGQASDIEIHAKEILALKGRLNEILAKHTSQTIRTIEKDTDRDNFLGAEAAVKYSLVDAVLTSRKVKHE

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.434 kDa

MQPMFDRERNGLDTTGLGLIPMVIETSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLESENSEKDIFLYINSPGGLVTAGLAVYDTIQFIKPDVSTLCVGQAASMGAFLLTAGAKGKRYCLPNSRVMIHQPLGGFQGQASDIEIHAKEILALKSRLNEIMAKHTGQTVKAIERDTDRDNFLGAEAAVKYGLVDAVLTSREVKQE

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.569 kDa

MSQFNPMGGQSTTIQSSLVPIVVEQTARGERSYDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGSFLLSAGATGKRFCLPNARTMIHQPSGGAQGQASDIHIHAQEILKIRARLNEIMAKHTGKSVEEVARDTERDNFMSAEESKAYGLVDDVLYQRVPEESK

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.443 kDa

MQPILDWEKNELNTTGLGLIPMVIESSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLESENSEKDISLYINSPGGLVTAGLAVYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKGKRYCLPNSRVMIHQPLGGFQGQASDIEIHAKEILALKGRLNEILAKHTSQTIRTIEKDTDRDNFLGAEAAVKYSLVDAVLTSRKVKHE

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.434 kDa

MQPMFDRERNGLDTTGLGLIPMVIETSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLESENSEKDIFLYINSPGGLVTAGLAVYDTIQFIKPDVSTLCVGQAASMGAFLLTAGAKGKRYCLPNSRVMIHQPLGGFQGQASDIEIHAKEILALKSRLNEIMAKHTGQTVKAIERDTDRDNFLGAEAAVKYGLVDAVLTSREVKQE

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.569 kDa

MSQFNPMGGQSTTIQSSLVPIVVEQTARGERSYDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGSFLLSAGATGKRFCLPNARTMIHQPSGGAQGQASDIHIHAQEILKIRARLNEIMAKHTGKSVEEVARDTERDNFMSAEESKAYGLVDDVLYQRVPEESK

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.775 kDa

MPGYSDNIIRNASGLIPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDISLYINSPGGVVTAGLAIYDTMQFIKPDVSTLCIGQAASAAALLLCAGAEGKRFCLPNSRVMIHQPLGGYRGQATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAMEYGLIDKVLYDRQVAGHSTDL

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.824 kDa

MPGYSDYIIRNASGLIPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDISLYINSPGGVVTAGLAIYDTMQFIKPDVSTLCIGQAASAAALLLCAGAEGKRFCLPNSRVMIHQPLGGYRGQATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAMEYGLIDKVLYDRQVAGHSTDL

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.775 kDa

MPGYSDNIIRNASGLIPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDISLYINSPGGVVTAGLAIYDTMQFIKPDVSTLCIGQAASAAALLLCAGAEGKRFCLPNSRVMIHQPLGGYRGQATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAMEYGLIDKVLYDRQVAGHSTDL

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.775 kDa

MPGYSDNIIRNASGLIPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDISLYINSPGGVVTAGLAIYDTMQFIKPDVSTLCIGQAASAAALLLCAGADGKRFCLPNSRVMIHQPLGGYRGQATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAMEYGLIDKVLYDRQIAGHSTDL

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.573 kDa

MSDERREGLAPEIEATGLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDHMANLIVAQLLFLESENPDKDIHIYINSPGGAVTAGLAIYDTMQFIKPDVSTVCIGQAASMGALLLTGGTKGKRYALPNSRMMIHQPLGGFQGQATDVDIHAREILDMRDRLNRIMAHHTGQDMETIARDTDRDNFMSPDTACEYGLVDAVLADRKALDQA

clpP

ATP-dependent Clp protease proteolytic subunit

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.728 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRFSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDKFLTAEMAREFGIVDKVIDKRAEETASASGPKAP

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.578 kDa

MSRNSYIQQNSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFMVGPVEDYMANLIAAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAGGAEGKRHCLPNSRMMIHQPLGGFQGQASDIDIHAKEILHIRHRLNSLLAHHTGQSLETIERDTERDNFMSAERAAEYGLIDSVINKRQMPA

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.388 kDa

MSRNSYIQQSSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAAGKRHCLPNSRVMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAHHTGQSLETIKRDTERDNFMSAARAAEYGLIDSVYDKRQLAS

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.661 kDa

MSRNPFMQNMPEIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGQVEDYMANLICAQLLFLEAENPDKDIHLYINSPGGSVTAGMAIYDTMQFIKADVSTTCIGQACSMGAFLLAGGAKGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFIRERLNELLAHHTGQSLETIERDTNRDNFMSAPRAVEYGIVDAVHEKRQMPV

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.515 kDa

MSRNSYIQQSSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSVYDKRQLAS

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.535 kDa

MSRNSYIQQSSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQMLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLTAGAKGKRHCLPNSRVMIHQPLGGFQGQATDIQIHAQEILSIKARLNELLAYHTGQDLETIQRDTERDNFMSASRAAEYGLIDSVYDKRQLAS

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.515 kDa

MSRNSYIQQSSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSVYDKRQLAS

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.529 kDa

MQRFEWKQRNHEPQDLGLIPMVIETSGRGERAYDIYSRLLRERVIFLVGPVTEASANLIVAQLLFLESENADKDIHFYINSPGGLVSAGMAVYDTMQFIKPDVSTLCIGQAASMGSLLLAAGAKGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAREILYLKNRLNELLSKHTGQSMETIERDTDRDNFLGAEDSVKYGLVDAVLTSRGEGAG

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.529 kDa

MQRFEWKQRNHEPQDLGLIPMVIETSGRGERAYDIYSRLLRERVIFLVGPVTEASANLIVAQLLFLESENADKDIHFYINSPGGLVSAGMAVYDTMQFIKPDVSTLCIGQAASMGSLLLAAGAKGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAREILYLKNRLNELLSKHTGQSMETIERDTDRDNFLGAEDSVKYGLVDAVLTSRGEGAG

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.15 kDa

MIHYPATAQSQFEAQGLGYIPMVIEQSGRGERSYDIYSRLLKERIIFLVGPVNDATANLVVAQLLFLEAENPDKDIYFYINSPGGSVTAGMGIYDTMQFVKPDVSTLCVGQAASMGALLLAAGAQGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFLREKLNHILASHTGQPVEKIALDTDRDNFMSAEQSVAYGIVDKVIASRADAA

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.533 kDa

MSRNSYIQQSSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQMLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSVYDKRQLAS

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.578 kDa

MSRNSYIQQNSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFMVGPVEDYMANLIAAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAGGAEGKRHCLPNSRMMIHQPLGGFQGQASDIDIHAKEILHIRHRLNSLLAHHTGQSLETIERDTERDNFMSAERAAEYGLIDSVINKRQMPA

clpP

ATP-dependent Clp protease proteolytic subunit

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.578 kDa

MSRNSYIQQNSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFMVGPVEDYMANLIAAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAGGAEGKRHCLPNSRMMIHQPLGGFQGQASDIDIHAKEILHIRHRLNSLLAHHTGQSLETIERDTERDNFMSAERAAEYGLIDSVINKRQMPA

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.333 kDa

MMNTPFDPTNALVPMVVEQTAKGERSYDIYSRLLKENVIFMVGQVEDHMANLIVAQMLFLEAENPEKDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTVCIGQAASMGAFLLSGGAKGKRYCLPNARVMIHQPLGGFQGQASDFEIHAKEILSIKEKMNRLMAAHTGQDYDKVARDTDRDNFLSAQESVDYGLVDQVLANRPDASNSDAKK

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.475 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGGVEDNMSMLVVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMRHALPNARIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQTYQAIEDALERDKFLTADMARDFGIVDKVIDKRAEDPAAPKASS

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.252 kDa

MLYDFERTAPEPQGLGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDATANLIVAQMLFLESENPDKDIYLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCIGQAASMGAFLLTAGAKGKRYCLPNSRVMIHQPLGGFQGQASDIEIHAKEILYLKARLNGMLAKHTGQSLEVIDRDTDRDNFMSAEDSVKYGLVDKVLTSRNEAGN

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.475 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGGVEDNMSMLVVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMRHALPNARIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQTYQAIEDALERDKFLTADMARDFGIVDKVIDKRAEDPAAPKASS

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.252 kDa

MLYDFERTAPEPQGLGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDATANLIVAQMLFLESENPDKDIYLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCIGQAASMGAFLLTAGAKGKRYCLPNSRVMIHQPLGGFQGQASDIEIHAKEILYLKARLNGMLAKHTGQSLEVIDRDTDRDNFMSAEDSVKYGLVDKVLTSRNEAGN

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.091 kDa

MNSAAPHGSSNWDPVGLGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLIVAQLLFLESENPDKDVYFYINSPGGSVSSGMAIYDTMQFIKPSVSTLCIGQAASMGSFLLAAGEKGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAREILGIRAKLNEMLAKHTGQPIEQIEKDTDRDRFMSAADAVEYGIVDKVLTNRADS

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.195 kDa

MNAGTPQHSSAWDPVGLGLIPMVVEQSGRGERSYDIYSRLLKERVVFLVGPVNDVTANLIVAQLLFLESENPDKDIYFYINSPGGSVTAGLAIYDTMQFIKPNVSTLCIGQAASMGAFLLAAGEKGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAREILYLRERLNGMLAKHTGQTIEQIEKDTDRDNFMSATAAVEYGLVDKVLTSRADT

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.524 kDa

MTPQSQPQETAVALIPYVIEQTSKGERSYDIYSRLLKDRIIILGTAVTDEVANSIIAQMLFLEVDNPEKPIHLYINSPGGSVSAGLAIYDFMQFVKCDVATYCMGMAASMGSLLLTAGTKGMRYSLPNTRIMIHQPLLSGGGLSGQVTDIEIHAKELVKTKEKLTRIYETHTGRDYDTLRAAMERDNFMDPYQAKEFGLLDHVVESRKAKKG

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.383 kDa

MSNIDLSASSNLNVENTLVPMVVEQTARGERSYDIYSRLLKERVIFLVGQVEDHMANLVVAQMLFLEAENPDKDIHLYINSPGGSVTAGLSIYDTMQFIKPDVSTMCIGQACSMGAFLLTAGAKGKRFCLPNARTMIHQPSGGAQGQASDIHIQAQEILKLRERLNEIMAGHTGRGVEEIARDTERDRFMSAHESVEYGLIDKVLERRVGGE

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.437 kDa

MQNVRDWQWSQPAPQALGLVPMVVEQSGRGERAYDIYSRLLKERIVFMVGPVTDETANLVVAQMLFLESENPDKDIHLYINSPGGSVTAGLSIYDTMNFIKPSVSTLCIGQAASMGAFLLSAGAKGKRFALPNSRVMIHQPLGGFQGQASDFEIHAREILTLKRKLNELMAAHCGRPLEDLERDTDRDNFMNAAQALEYGLIDQVLENRAAV

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.54 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRFSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDKFLTADMARDFGIVDKVIDKRAEESAPGPKVA

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.59 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRFSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDKFLTAEMAREFGIVDKVIEKRPEDPAPAPKAA

clpP

ATP-dependent Clp protease proteolytic subunit

212 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.59 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRFSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDKFLTAEMAREFGIVDKVIEKRPEDPAPAPKAA

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.478 kDa

MFRNSYIQQNSDIQAAGGLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAPGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAREYGLIDEVINQRPA

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.42 kDa

MFRNSYIQQNSDIQAAGGLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEEIERDTNRDNFMSAEAARDYGLIDAVIDKRPA

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.45 kDa

MFRNSYIQQNSDIQAAGGLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAPGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAKEYGLIDEVINQRPA

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.455 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDNMSMLVVAQLLFLEADNPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMRHALPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERDKFLTADMARDFGLVDKVIDKRAEEPAAPKAS

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.455 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDNMSMLVVAQLLFLEADNPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMRHALPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERDKFLTADMARDFGLVDKVIDKRAEEPAAPKAS

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.466 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLCAGAKDMRFSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERDKFLTADMARDFGLVDKVIDKRPEEASPAKPV

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.435 kDa

MRDPVDTYMNYLIPMVVEQTNRGERSYDIFSRLLKERIIFLTGPVEDGMSTLAVAQLLFLEADNPKKEISMYINSPGGVVTSGLAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGEKDMRFALPNARIMVHQPSGGFQGQVTDIMLHAQEILNLKRRLNEIYVKHTGRSMDKIEDALERDNFMTAKAALDFGLIDAVIDQRPTDDTSKAA

clpP

ATP-dependent Clp protease proteolytic subunit

211 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.476 kDa

MPIGVPKVPFRIPGEEDASWIDVYNRLYRDRLLFLGQDVDDEIANQLIGIMIYLNGENQSKDMYMYINSPGGAVLAGISVYDAMQFVVPDVHTICMGLAASMGSFILTGGEISKRLALPHARVMIHQPASSFYEGQAGECMIEAEEVLKLKDCVTKVYMQRTGKPMAVISEDMERDVFMSAKEAQAYGIVDLVATDDEPSTNTPFDYGRKW

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.086 kDa

MKSMMEPQGLGLVPMVVEQSGRGERAYDIYSRLLKERIVFLVGPVTDESANLVVAQMLFLESENPDKDIHFYINSPGGSITAGMSIYDTMNFIKPDVSTLCIGQAASMGAFLLAAGTHGKRFALENSRVMIHQPLLYGGGLSGQVTDIEIHARELVKVKAKMNELLAKHSGQTLERVQSDTERDNFMSAEEARAYGMIDKVLSSRRDVTA

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.364 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMRFSLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQSYQAIEDALERDNFLTAEKARDFGIVDKVIDKRPEDPVAKAA

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.364 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMRFSLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQSYQAIEDALERDNFLTAEKARDFGIVDKVIDKRPEDPVAKAA

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.902 kDa

MYDFEPKMNALVPMVIEQTNRGERGYDIYSRLLKERIIFLIGGVNDAVASLICSQLLFLESENPSKDIALYINSPGGYVSAGLAIYDTMQYIRPQVSTVCMGQAASMGSLLLAAGAPGKRFSLPNSRIMIHQPSGGAQGQASDIEIQAQEILKLRSRLNDIYVKHTGQSLDTIEAXMERDKFMSPEEAKAFGLIDEVVEKRPGSIGDGAA

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.264 kDa

MRDPVDTYMNYLVPMVVEQTNRGERAYDIYSRLLKERIIFLTGPVEDGMSTLAVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCIGQAASMGSLLLTAGEKGLRFALPNARIMVHQPSGGFQGQVTDIMLHAQEILSLKKRLNEIYVKHTGQPIEKIEDALERDNFMTANAAQEFGLIDTVIDKRPSDEPAKA

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.609 kDa

MSDLVKTALSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDSMAMLVCAQLLFLEAENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPISTLCMGQAASMGSLLLTAGAKGHRFSLPNARIMVHQPSGGFQGQASDIERHAQDIIRMKRHLNEIYVQHTGQDYEIIENTLDRDHFMTAEEAKMFGLIDDVIQYRAETKKEEKD

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.551 kDa

MSDPIKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLEAENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFTLPNARIMVHQPSGGFQGQASDIERHAQDIIKMKQRLNEIYVQHTGQNYDVIERTLDRDHFMTAEEAKQFGLVDDVIQYRAETEKEEKD

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.641 kDa

MSNPMKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDSMAMLVCAQLLFLEAENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFTLPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQDYEVIERTLDRDHFMTAEEAKQFGLVDDVIQYRAETEKEEKD

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.476 kDa

MSDPMKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLEAENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQGYEVIERTLDRDHFMTAEEAKAFGLVDDVIHYRAETEKEEKD

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.925 kDa

MSDTQQSAPDIFNTGLVPMVVEQSARGERAYDIFSRLLKERVIFLVGPVEDYQANLLVAQLLFLESENPDKDVHLYINSPGGSVTAGLAIYDTMQFIKPDVATLCVGQAASMGALLLAAGAEGKRHALPNSRMMIHQPLGGFQGQATDIDIHAREILSMRDRLNTILAHHTGQDIETIRQDTDRDNFMAAEAAAQYGLIDRVLTSRGASE

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.474 kDa

MKDPIDLYMNTLVPMVVEQTSRGERAYDIYSRMLKERIIFLSGPVHDGMSSLICAQLLFLEAENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGMRFSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVRHTGQDLETVEAALERDNFMSAEDAKAWGLIDEILESRNRPDDTAK

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.372 kDa

MIDPTETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQDYDTIEKALERDNFMSPEQAKEFGLIDEIVENRSKADDAES

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.901 kDa

MITTSMTRTSALDTDMLGMVPMVIEQSGRGERAYDIYSRLLKERIIFLVGPVNDQMANLIVAQLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFIKPNVSTLCTGLAASMGAFLLAAGEKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQAREILYLRERLNAILAERTGKSVEEIAKDTDRDNFMSADAAVTYGMIDKVLATRA

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.277 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMATLIVAQLLFLEAENPKKEIAMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCTGQAASMGSLLLCAGHKDMRFSLPNSRIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQSYKAIEDALERDKFLTAEAAAEFGLIDKVIDKRPEDPAPMAK

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.404 kDa

MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLTVAQLLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHPDMRFSLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERDKFLTADMARDFGIVDKVIDKRSEEPTPKAP

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.474 kDa

MKDPIDLYMNTLVPMVVEQTSRGERAYDIYSRMLKERIIFLSGPVHDGMSSLICAQLLFLEAENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGMRFSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVRHTGQDLETVEAALERDNFMSAEDAKAWGLIDEILESRNRPDDTAK

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.474 kDa

MKDPIDLYMNTLVPMVVEQTSRGERAYDIYSRMLKERIIFLSGPVHDGMSSLICAQLLFLEAENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGMRFSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVRHTGQDLETVEAALERDNFMSAEDAKAWGLIDEILESRNRPDDTAK

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.335 kDa

MKDPIDLYMNTLVPMVVEQTSRGERAYDIFSRMLKERIIFLSGPVHDGMSSLICAQLLFLEAENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGMRFSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVKHTGQDLDTVEAALERDNFMSAEDAKAWGLIDEILESRGKTDDTAK

clpP

ATP-dependent Clp protease proteolytic subunit

210 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.352 kDa

MSHDHADIVNALIPMVVEQSNRGERSFDIYSRLLRERIIFVTGQVEDHMASVICAQLLFLEAENPKKDIFLYINSPGGVVTAGLAIHDTMQYIRPKVGTLCIGQAASMGSFLLAAGEPGMRVATTNSRIMIHQPSGGAQGMAADIEIQAREILRMRKRLNALYAKYTNQPIEEIEKAMDRDNFLEADEAKAFGLIDKVFDKRPVASEEKE

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.927 kDa

MNIDNASNWDPQALGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLVVAQLLFLEAENPDKDIYFYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLNAGAKGKRFALPNSRVMIHQPLGGFQGQASDIAIHAKEILSIRDRLNRIMAEHSGQPLERIEKDTDRDNFLSAAEAAEYGLIDKVLTRRDAA

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.927 kDa

MNIDNASNWDPQALGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLVVAQLLFLEAENPDKDIYFYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLNAGAKGKRFALPNSRVMIHQPLGGFQGQASDIAIHAKEILSIRDRLNRIMAEHSGQPLERIEKDTDRDNFLSAAEAAEYGLIDKVLTRRDAA

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.439 kDa

MSYLYDSYFQYIHYNVSMIPTVVKQTSRGDRAYDIFSLLLKERIIFVIGKIENFMANLIVAQIMFLESEDPVKDIHLYINSPGGEVTAGMSIYDIMQFVKPNISTYCIGQAASMGAFLLAAGTTGKRFCLPNSRVMIHQPLGSLHGQATDIAIHATEILKVKENINKLMAKHTGKSIDVIRQDMERDCFLSADESVKYGLVDSVLSKRI

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.259 kDa

MFDPVDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFINGPIHDGMSHLIVAQLLHLEAENPNKEISIYINSPGGVVTSGLSIYDTMQYIKPKCSTLVIGQAASMGSVLLAGGEKGMRFSLPNSRIMVHQPSGGYQGQASDIMIHAAETQKLKDRLYDIYVKHTGQTKKAVEKALDRDNFMSPEEAKEWGHIDEIVESRSKGDDAE

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.1 kDa

MPIGVPKVPFRLPGDEDAVWIDVYNRLFRERLLFLGQQVDDELANQLICIMIYPNGEDDSRDMYLYVNSPGGAVFAGISIYDAMQFVVPDVQTICIGLAASMGSFVLAGGEITKRIALPHARVMIHQPASSYYEGQVGECIMEAEEVLKIRDCITKVYAQRTGKPLWVVSEDTERDVFTSAEEAKVYGVIDPVAVETSSNSPISKLTKS

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.424 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.424 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.424 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.424 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.44 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALLNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.44 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALLNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.424 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.452 kDa

MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDHFMTAQEALEFGLIDKVVEVRDVSADESK

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.466 kDa

MDDIFNMTVPIVVENNGRNERAYDIYSRLLKDRIVLLGTEVNDQVASLICAQLLFLESQDPEKEIYLYINSPGGSVTAGLAIYDTMNYITPNVATVCMGRAASMGALLLAAGEKNMRYALPNSQVMIHQPLGGYQGQATDIDIHAREILRMRQRLNEILMEQTGQSLEKVAQDTERDYFMTAEDAKAYGLIDKVLVSRKDLDIEHEKTE

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.989 kDa

MYDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHFMSADEAKAWGLVDHVYDSRDAAEAGAE

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity (By similarity). Plays a major role in the degradation of misfolded proteins (By similarity). Required for degradation of response regulator CtrA, thus contributing to the G1-to-S transition (PubMed:9755166). Required to degrade DNA replication inhibitor toxin SocB, this function is probably the reason why the protease is essential in this organism (PubMed:24239291).

Belongs to the peptidase S14 family.

22.989 kDa

MYDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHFMSADEAKAWGLVDHVYDSRDAAEAGAE

clpP

ATP-dependent Clp protease proteolytic subunit

209 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.19 kDa

MRDPVEFYNSALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYSASLIVAQLLFLEAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVATLCVGQAASMGSLLLAAGEPGHRFALPNARIMVHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDTIELGLERDNFMTADAAREWGLIDEVLQKRAEASPAA

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.979 kDa

MSYQEKNAMSPIIDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVIERDTDRDNFMSADQAVEYGIVDAVLSHRGE

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.979 kDa

MSYQEKNAMSPIIDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVIERDTDRDNFMSADQAVEYGIVDAVLSHRGE

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.078 kDa

MKDPIETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMVHQPSGGYQGQATDIMIHAAETQKLKDRLNEIYVKHTGQTMKKVVDALERDNFMSPEEAKEFGLIDEIVENRSKDDAET

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.982 kDa

MHDPVEYFQNNLVPMVVEQTSRGERAYDIFSRLLKERIVFVNGPVHSGMSHLIVAQLLHLEAENPSKEISMYINSPGGEVTAGMSIYDTMQYIKPKVSTLVCGMAASMGSVIAVGGEKGMRLALPNAEFLVHQPSGGARGTASDILISARSIEATRERLYQLYVKHTGQDYETVQRALDRDTWMTPEVALEWGHVDEIVTTRGADDAE

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.962 kDa

MDNRTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVVVAQLLFLESENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPNVSTTCIGQAASMGALLLAAGEAGKRYALPNSRVMIHQPLGGYQGQATDIDIHAREILTLRSRLNEVLAKHTGQSLETIARDTERDNFKSAFEAQAYGLVDQVLERRPDESIQAG

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.103 kDa

MSYQEKNTMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVVAQLLFLESENPDKDIYLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGTPGKRHVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVVERDTDRDNFMSADQAVEYGLVDSVLNHRGQ

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.248 kDa

MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIVAQLLFLESENPNKDICMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLLAAGTKGKRYSLPHSRIMIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLKKIEGMMERDKFMDPEEARKIGLIDRVIAERTDIEIENIKVKQKVG

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.371 kDa

MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIVAQLLFLESENPDKDICMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLLTAGAEGKRYSLPHSRIMIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLKKIEEMMERDKFMDPEEAMKTGLIDRVIAERKDMKIENIKVKQKVV

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.384 kDa

MTLIPIVIEQTSRGERAYDIYSRLVKERIIFVTGPVEDNMASVIVAQLLFLESENPDKDIYMYINSPGGVVTAGLSIYDTMQYIKPDVSTLCIGQAASMGSLLLAAGTEGKRYSLPHSRIMIHQPSGGYQGQATDIEIHANEILRVKRKLNQIYEKHTGNSLKKIEGMMERDKFMDPEEARRIGLIDRVIAERKDIKVENIKVEQKVG

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.249 kDa

MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIVAQLLFLESENPDKDICMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLLAAGTKGKRYSLPHSRIMIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLKKIEGMMERDKFMDPEEARKIGLIDRVIAERTDIEIENIKVKQKVG

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.796 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDQVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.796 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDQVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.805 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDHVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.796 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDQVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.805 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDHVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.796 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDQVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.796 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDQVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.796 kDa

MSIVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDAQAYGLVDQVLERRPEESIQPS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MHDPVDTYMNLVPMVVEQTSRGERAYDIFSRLLKERIVFVNGPVHDGMSQLVVAQLLHLEAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGEKGMRFSLPNSRIMVHQPSGGYQGQATDIMIHAQETQKLKDRLNQIYVKHTGQPLKKVVDALERDNFMDAEQAKEWGLIDEIVESRANEDTSK

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.324 kDa

MQCSHNFKTPYCHRMVVVPTVIEHTIRGDRVYDIFSLLLKERIIFMTGTIEDSVANLIVAQMMFLESENSEKDIHLYINSPGGVITAGMSIYDTIQFVRPDVSTFCMGQAASMSAFLLASGTKGKRFCLPNARIMIHQPLGSFQGQATDIAIHTREILKIKNNINKLMAKHTGQSIDIINKDTERDCFLSADEAMKYGLVDCVLSQRI

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.444 kDa

MLYDQIKNNKTSSYATFIPMVVEQHSRGERSYDIYSRLLKERIIFITGAIEDNMANNIVAQILFLEAENPEKDIFLYINSPGGIITSGMSIYDTMQFVKPEISTICLGQACSMAALLLTSGAKGKRFCLPNSKVMIHQPLGGYQGQASDIAIHAREIMEMKKKLNKLMSFHTGQSIKKINKDTERDCFLSANQSIKYGLIDFILSQRQ

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.103 kDa

MYDPMATAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLQAGAPGHRIALPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHTGRTYEEVEKTLDRDHFMSAEEAKAWGLIDHINESRDEADEKA

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.098 kDa

MRDPVDYFHNSLVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDQGASLIVAQLLFLEAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLAAGEAGHRFALPNARIMVHQPSGGFQGQATDILIHAREIEALKKRLNEIYVKHTGREYETIHQALERDNFMTADAAKEFGLIDDILHKRPEPAAA

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.098 kDa

MRDPVDYFHNSLVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDQGASLIVAQLLFLEAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLAAGEAGHRFALPNARIMVHQPSGGFQGQATDILIHAREIEALKKRLNEIYVKHTGREYETIHQALERDNFMTADAAKEFGLIDDILHKRPEPAAA

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.084 kDa

MRDPVDYFHNSLVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDQGASLIVAQLLFLEAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLAAGEAGHRFALPNARIMVHQPSGGFQGQATDILIHAREIEALKKRLNEIYVKHTGRDYETIHQALERDNFMTADAAKEFGLIDDILHKRPEPAAA

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.081 kDa

MRDPIDVYNNALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYGASLIVAQLLFLEAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLTAGEPGHRFALPNARIMVHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDTIHTALERDNFMTADAAKEFGLIDEVIEKRPEPAAA

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.993 kDa

MPVGVPKVPYRLPGESAPQWVDLYNRLYRQRLLFMGQELGDELSNQLCGIMIYLFAEDPSIPLFMYINSPGGSVTSGLGVFDIATVMMQDVTTICVGIAASMASLVLSGGSTGQRLALPHARMMIHQPEGGSRGQASDVMYESSEVERLRDIVVDCYVERTHQSRETIIIDLNRDLFMSPRQARSYGLIDAVALPAVKEEYTGFSMFS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.795 kDa

MDDVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDAQAYGLVDQVFGQRQEELIQSS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.73 kDa

MDDVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDAQAYGLVDQVLGQRPEELIQSS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.781 kDa

MDDVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRVMIHQPLGGFQGQATDVDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDAQAYGLVDQVFGQRQEELIQSS

clpP

ATP-dependent Clp protease proteolytic subunit

208 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.795 kDa

MDDVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDAQAYGLVDQVFGQRQEELIQSS

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.814 kDa

MYKNYNDVTESPRNALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDQDISIYINSPGGAVTAGMSIYDTMQFIKPDVSTVCMGQACSMGAFLLAGGAKGKRFCLPSARVMIHQPLGGFQGQASDIQIHAQEILKIKNTLNERLAFHTGQEMATIERDTDRDNFMSADQAVAYGLVDGILSQRG

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.249 kDa

MSFNDTQEQFAPNMALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDINLYINSPGGVITAGMSIYDTMQYIKADVSTICMGQACSMGAFLLSAGAKGKRICLPNSRVMIHQPLGGYQGQATDIQIHAQEILKVKSRMNELMAQHTGKSIEEIERDTERDRFLSANEALEYGLVDKVYTQRS

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.858 kDa

MNAMVLDDVIKSQAGYLNPYILEERQLNVTQLDVFSRLMMDRIIFLGTQIDDYTANTLQAQLLYLDSVDPGKDISIYINSPGGSVYAGLGIYDTMQFISSDVATICTGMAASMASVLLVAGAKGKRSALPHSRVMIHQPMGGAQGQASDIEITAREIQKLKKELYTIIADHSGTSFDKVWADSDRDYWMTAQEAKEYGMIDEVLIKK

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.046 kDa

MSYSGEQERQAPHMALVPMVVEQTARGERSYDIYSRLLKERIIFLTGQVEDYMANLVVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAIERDTERDRFLSASEAVEYGLVDSVFTNRG

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.292 kDa

MSYSDKRDQYAPHMALVPMVVEQTTRGERSYDIYSRLLKERIIFLTGQVEDHMANLVAAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAQEILKVKSRMNELMAKHTGRPIEEIAKDTERDRFLSADEAVEYGLVDKIFTHRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. May play the role of a master protease which is attracted to different substrates by different specificity factors such as ClpA or ClpX. Participates in the final steps of RseA-sigma-E degradation, liberating sigma-E to induce the extracytoplasmic-stress response. Degrades antitoxin MazE (PubMed:24375411).

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.187 kDa

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.159 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGISIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.159 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGISIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.177 kDa

MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.875 kDa

MSYQENNAMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLEVIEQDTDRDNFMSADDAVKYGLVDAVLNKRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.875 kDa

MSYQENNAMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLEVIEQDTDRDNFMSADDAVKYGLVDAVLNKRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.859 kDa

MSYQENNAMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLEVIEKDTDRDNFMAADDAVKYGLVDAVLNKRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.644 kDa

MSNPFAGNTDPISNALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGPVEDHVANVIAAQLLFLESESPEKDIFIYINSPGGSISAGMAIYDTMQFIKPDVSTVCMGMAASMGAFLLASGAPGKRHCLPNAKVMIHQPLGGFQGQASDFEIHAKEILATKHRMNELLAFHTGKDIEIIAQDTDRDNFMRASEAVEYGIVDSVLTHRK

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.256 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEIERDTERDRFLSADEAVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.256 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEIERDTERDRFLSADEAVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.32 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEIERDTERDRFLSAEQSVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.32 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEIERDTERDRFLSAEQSVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.32 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEIERDTERDRFLSAEQSVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.32 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEIERDTERDRFLSAEQSVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.32 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEIERDTERDRFLSAEQSVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

207 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.32 kDa

MSYSGERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEIERDTERDRFLSAEQSVEYGLVDSVFTRRD

clpP

ATP-dependent Clp protease proteolytic subunit

206 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.578 kDa

MGNEFDISNAGGLVPMVVEQNARGERAYDIYSRLLKERVIFLIGPVEDYMANLVVAQMLFLESENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTVCVGQAASMGALLLAGGAAGKRYCLPHSRMMIHQPLGGYQGQAADIEIHTKEILNIRQQLNEILAKHTGQDAETVARDTDRDNFMNGTQAVEYGLIDAMLDKRPVS

clpP

ATP-dependent Clp protease proteolytic subunit

206 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.963 kDa

MSSDIQDPMAQLVPMVVEQTSKGERSYDIYSRLLKERVIFCCGQVEDHMANLIVAQLLFLESDNPDKDIYLYINSPGGVVTAGMAIYDTMRFIKPDVSTVCMGQAASMGAFLLAGGAQGKRYCLPNSRVMIHQPLGGFQGQASDFEIHAKQILDLKERLNRMLAENTGQDYEKVARDTDRDHFLSAEESIDYGLVDGILRQRGEES

clpP

ATP-dependent Clp protease proteolytic subunit

206 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.951 kDa

MSYSDQRELAPHMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLAAGAQGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILSIKARMNTLMAKHSGQPIEVIERDTERDRFMSAQDAVEYGLVDAVLTQRA

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.525 kDa

MSQLIKDPTNLGLVPVVIEQTARGERSFDIYSRLLKERVIFMIGQVEDHMANLIVAQMLFLESENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGAFLLTAGAAGKRFALPNARVMIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFMSADEAKEYGIIDAVLSQRPV

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.55 kDa

MNIGITDPLNALVPMVVEQTPKGERSYDIYSRLLKERIIFLTGPVEDNMANLILAQMLFLESENPDKDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTICVGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGFQGQASDFEIHAKEILSIKDKLNRLMAEHTGQPLDVISKDTDRDNFMSADQAVDYGIVDSVFKNRASK

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.47 kDa

MPLIPMVVEQSNRGERAYDIYSRLLKDRIIFLGSAMDDEVANLIVAQLLFLESEDPEKDINFYINSPGGVVTAGMAVYDTMQYIKPDVATVCIGQAASMGALLLAAGAKGKRFSLPNSRIMIHQPLGGAQGQASDIKIQANEILRMKEVLSGILSKHTGQNFDKISEDTDRDFFMSGDQAKEYGLVDHVVASRDELEKAEAAKEK

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.582 kDa

MPLIPMVIEQTSRGERAFDIYSRLLKDRIVFIGSAIDDETANLLIAQLLFLESEDPDKDINFYINSPGGKVSAGMAIYDTMQYIKSDIATVCIGHAASMGAFLLAAGAKGKRFSLPNSRIMIHQPMGGAQGQASDIAIQAKEILRMKDILNQILAHHTGKPLEQIQVDTDRDFFMSGEEAKAYGIVDHVITDRSDLDKLEKPQEA

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.47 kDa

MPLIPMVVEQSNRGERAYDIYSRLLKDRIIFLGSAMDDEVANLIVAQLLFLESEDPEKDINFYINSPGGVVTAGMAVYDTMQYIKPDVATVCIGQAASMGALLLAAGAKGKRFSLPNSRIMIHQPLGGAQGQASDIKIQANEILRMKEVLSGILSKHTGQNFDKISEDTDRDFFMSGDQAKEYGLVDHVVASRDELEKAEAAKEK

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.582 kDa

MPLIPMVIEQTSRGERAFDIYSRLLKDRIVFIGSAIDDETANLLIAQLLFLESEDPDKDINFYINSPGGKVSAGMAIYDTMQYIKSDIATVCIGHAASMGAFLLAAGAKGKRFSLPNSRIMIHQPMGGAQGQASDIAIQAKEILRMKDILNQILAHHTGKPLEQIQVDTDRDFFMSGEEAKAYGIVDHVITDRSDLDKLEKPQEA

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.147 kDa

MSYSCEYTPLNMALVPMVVERTLRGERSYDIFSRLLKERIIFMTGKVEDYMANIIVAQMIFLEAENPEKDIYLYINSPGGNITSGMSIYDTMQFIKPNVSTFCMGQAASMGAFLLAAGTKGKRFCLPNARMMIHQPMGGFQGQATDIQIHAKEILKVKNRMNELMAKHIGKTLQVIEQDTERDRFLSANEAVDYGLVDAILSHRI

clpP

ATP-dependent Clp protease proteolytic subunit

205 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.922 kDa

MPVGVPKVPFRAPGDEDATWVDLYNRLYRERLLFLAQDINNEIANQLMGLMVYLSAEDANKEIFSFINCPGGSVIPGVGLYRMMQAIVPDVNTICMGVAASMGSFILIGGEMPKRIALPHARVMIHQPASSYYDGSAADFHNESKHVTLVREYITECYIERTGQPEEVIQRDLNRDVFMSATEAQAYGIVDVVAEDPLIFNRFLK

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.026 kDa

MEVMSVIPYVIEQTGRGERSYDIYSRLLKDRIIFVGTPVESQMANSIVAQLLLLDSQNPEQEIQMYINCPGGEVYAGLAIYDTMRYIKAPVSTICVGMAMSMGSVLLMAGDKGKRMALPNSRIMIHQGSAGFRGNTPDLEVQAKEVLKLRDTLVDIYHKHTDLPQEKLLRDMERDYFMSPEEALKYGLIDQVIDQTRENRGGEE

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.026 kDa

MEVMSVIPYVIEQTGRGERSYDIYSRLLKDRIIFVGTPVESQMANSIVAQLLLLDSQNPEQEIQMYINCPGGEVYAGLAIYDTMRYIKAPVSTICVGMAMSMGSVLLMAGDKGKRMALPNSRIMIHQGSAGFRGNTPDLEVQAKEVLKLRDTLVDIYHKHTDLPQEKLLRDMERDYFMSPEEALKYGLIDQVIDQTRENRGGEE

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.508 kDa

MNKLEIANALVPMVVEQTARGERSYDIYSRLLKERIIFLVGQVEDHMANLVVAQLLFLESENPDKDIHLYINSPGGSVTAGLSIYDTMQFIKPDVSTMCIGQAASMGALLLSGGAAGKRYCLPHSRVMIHQPLLGGLQGQASDIEIHAKEILLLREKLNNILSKHTGQDIETIARDTDRDKFMDAEMAKNYGLIDSVLDKRVVG

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.925 kDa

MPIGVPKVPFRNPGEEDAVWVDVYNRLHRERLLFLGQEVDSEISNQIVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTMQFVLPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQARDFILEAEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHGIVDLVAIENENTGNSI

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.606 kDa

MSFDNHLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEAKEYGLIDQVLENRASLRL

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.652 kDa

MSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEAKEYGLIDQILENRASLQF

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.604 kDa

MSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEAKEYGLIDQVLENRASLQL

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.704 kDa

MSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCDRDLADLERDTDRDNFMSAEEAKEYGLIDQILENRASLRL

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.652 kDa

MSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEAKEYGLIDQILENRASLQF

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.599 kDa

MPYIPMPYVVEQTHRGERSYDIYSRLLKDRIVFLGTPIDDDVANVVIAQLLFLESEDPDKDISLYINSPGGSVTSGLAIYDTMQYVKPQVSTICLGQAASMGAFLLAGGAAGKRFAVPNARIMIHQPMGGFQGQATDIDIQAREILRLKAKLNDILAKHTKQPLERIEKDTDRDYFMGAGEAKEYGLIDEVIVHKPKATEKKAQ

clpP

ATP-dependent Clp protease proteolytic subunit

204 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.819 kDa

MPIGVPKVPFRLPGEEDAVWIDVYNRLYRERLLFLGQHVDDEIANQLIGIMMYLNGEDESKDMYLYINSPGGAVLAGISVYDTMQFVVPDVHTICMGLAASMGSFILTGGEITKRIALPHARIMIHQPASSYYDGQAGECIMEAEEVLKLRDCITKVYVQRTGKPLWVISEDMERDVFMSAKEAQIYGIVDFVAIETTSNSLTN

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.335 kDa

MNLIPMVVEQTPRGERSYDIYSRLLKERIIFLGSGVNDDVANVIVAQLLFLEAEDPEKDITFYINSPGGSVTAGMAIYDTMQYIKCDIATLCMGQAASMGAVLLAAGTAGKRYALPNSRIMIHQPLGGFQGQATDIEIHTKEILRIRKDLNNILAHHTGKTLKKIESDTERDNFMSSVEAQKYGLIDEVLVKREDVEGAADNG

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.326 kDa

MIDSLNTLVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPDKDIHLYINSPGGSVTAGLSIYDTMQFIKPDVSTLCVGQAASMGAVLLAGGAGGKRHCLPHSRLLIHQPLGGFQGQATDIDIHAREILLVRERLNHILAKHTGQPIEKIQHDTDRDYFMSATESLAYGLVDSVLKQRAEISL

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.573 kDa

MTVKEKKIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.573 kDa

MTVKEKKIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.573 kDa

MTVKEKKIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.335 kDa

MNLIPMVVEQTPRGERSYDIYSRLLKERIIFLGSGVNDDVANVIVAQLLFLEAEDPEKDITFYINSPGGSVTAGMAIYDTMQYIKCDIATLCMGQAASMGAVLLAAGTAGKRYALPNSRIMIHQPLGGFQGQATDIEIHTKEILRIRKDLNNILAHHTGKTLKKIESDTERDNFMSSVEAQKYGLIDEVLVKREDVEGAADNG

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.326 kDa

MIDSLNTLVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPDKDIHLYINSPGGSVTAGLSIYDTMQFIKPDVSTLCVGQAASMGAVLLAGGAGGKRHCLPHSRLLIHQPLGGFQGQATDIDIHAREILLVRERLNHILAKHTGQPIEKIQHDTDRDYFMSATESLAYGLVDSVLKQRAEISL

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.573 kDa

MTVKEKKIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.573 kDa

MTVKEKKIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.573 kDa

MTVKEKKIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.45 kDa

MTTNLLDQMNTLVPMVVEQSNKGERAYDIYSRLLKERIIFLVGPINDNVASLVTAQLLFLESEDPKKEINLYINSPGGLVTAGLGIYDTMQYIKPDVSTLCIGQAASMGSFLLAAGKKGKRFSLPNSRIMVHQPSAGFQGQATDIEIHANEVLALKKRLNEIYSKHTGKSVDDVKKALERDNFMTPDTAKEFGLIDEVVENRS

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.349 kDa

MDIMNNLPIPMVVEQTGRGERAFDIYSRLLKERVVFLVGEVNDASANLVVAQLLFLEAENPDQDIHFYINSPGGSVTAGMSIYDTMQFIKPDVSTMVLGQAASMGAVLLAAGAAGKRYALPNSRVMIHQPLGGFRGQASDIDIHAREILFIRERLNQILAKHSGQDLETISRDTERDNFMSAERAQEYGLVDAILTHRESVSA

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.569 kDa

MPIGVPKVPFRSPGEEDAVWVDVNRLHRERLLFLGQEVDNEVSNQLVGLMVYLSIEDATKDLYLFINSPGGWVIPGMAIYDTMQFVSPDVHTICMGLAASMGSLILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEAEELLKLRETLTKVYVQRTGNPLWAVSEDMERDAFMSATEAQAHGIVDLVAVENENTNDFV

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.208 kDa

MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGKRHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLAEHTGQPLEVIERDTDRDNFMSATQAMDYGLVDSLLTSRS

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.163 kDa

MHNAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCMGQAASMGAFLLAGGAKGKRHCLPNSRVMIHQPLGGFQGQASDIAIHAKEILGIKNKLNQMLAEHTGQPLDIIERDTDRDNFMSATQAVEYGIVDSLLTSRG

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.133 kDa

MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGKRHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPLEVIERDTDRDNFMSATEAAEYGLVDSVIAKRS

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.136 kDa

MQNAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGKRHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLADHTGQPLEVIERDTDRDNFMSATEAAEYGLVDSVLDKRG

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.103 kDa

MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGKRHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPLEVIERDTDRDNFMSATEAAEYGLVDSVIAKRG

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.117 kDa

MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGKRHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPIEVIERDTDRDNFMSADEAAEYGLVDSVLAKRG

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.635 kDa

MPYIPMPYVVEQTHRGERSYDIYSRLLKDRIIFLGTPVDDDVANVIIAQLLFLESEDPDKDINLYINSPGGSVTSGLAIYDTMQYVKPQVSTICLGQAASMGAFLLAGGAAGKRFAVPNARIMIHQLSGGFQGQATDIEIQAKEALRLKAKLNEIMARHTRQPIERIERDTERDYFMSAGEAKEYGLIDDVFLHKKAADKKPQ

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.635 kDa

MPYIPMPYVVEQTHRGERSYDIYSRLLKDRIIFLGTPVDDDVANVIIAQLLFLESEDPDKDINLYINSPGGSVTSGLAIYDTMQYVKPQVSTICLGQAASMGAFLLAGGAAGKRFAVPNARIMIHQLSGGFQGQATDIEIQAKEALRLKAKLNEIMARHTRQPIERIERDTERDYFMSAGEAKEYGLIDDVFLHKKAADKKPQ

clpP

ATP-dependent Clp protease proteolytic subunit

203 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.649 kDa

MPYIPMPYVVEQTHRGERSYDIYSRLLKDRIIFLGTPVDDDVANVIIAQLLFLESEDPDKDINLYINSPGGSVTSGLAIYDTMQYVKPQVSTICLGQAASMGAFLLAGGAAGKRFAVPNARIMIHQLSGGFQGQATDIEIQAKEALRLKAKLNEIMARHTRQPIERIERDTERDYFMSAGEAKEYGLIDDVFLHKKAAEKKPQ

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.295 kDa

MSALETQALGMIPMVIEQSGRGERSYDIYSRLLKERIVFLIGEVNDQTANLVVAQLLFLESENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTMCLGFAASMGAFLLAAGAKGKRFSLPNSKIMIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKADTERDYFLTADEAKEYGLVDQVVTQRP

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.257 kDa

MSALETQALGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKRYSLPNSKIMIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPIEKVKADTERDYFMTADEAKDYGIVDQVIAKRP

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.271 kDa

MSALETQALGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKRYSLPNSKIMIHQVLGGARGQATDIEIHARDILRTKEQMNRILAERTGQPIEKVKADTERDYFMTADEAKDYGIVDQVIAKRP

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.598 kDa

MPIGVPKVPFRSPGEEDAAWVDIYNRLHRERLLFLGQELDSEISNQLVGLMVYLSIEDKTRDFFLFINSPGGWVIPGIGLYDTMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFVLEAEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFLSATEAQAHGIVDLVGDENMGDLV

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.515 kDa

MPIGVPKVLFGSPGEEDAAWVDIYNRLHRERLLFLGQELDSEISNQLVGLMVYLSIEDKTRDFFLFINSPGGWVIPGIGLYDTMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFVLEAEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFLSATEAQAHGIVDLVGDENMGDLV

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.503 kDa

MPIGVPKVPFRSPGEEDAAWVDVYNRLHRERLLFLGQEVDSEISNQIVGLMVYLSIEDGTRDLYLFINSPGGWVIPGIAIYDTMQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHAWVMIHQPASSFYEAPTGEFILEAEELLKLRETLTRVYVQRTGNPLWVVSEDLERDVFMSATEAQAHGIVDLVAVENSGNFT

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.647 kDa

MPIGVPKVPFRSPGEEDAIWVDVYNRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEAEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHGIVDLVAVENSGDFT

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.257 kDa

MSLIPMVIETTGRSERAYDIYSRLLKDRIVLLGSEVNDTVASLICAQLLFLESQDPEKEISLYINSPGGSVTAGLAIYDTLRFISAPVSTVCMGRAASMGAFLLAAGKPGLRYALPNSQIMIHQPSAGYQGQATDIEIHAKEVLRLKERLNRILAENTGRPYKDIVKATERDNFLTPEEAKDLGIIDRVLVSRQDMAQEKSE

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.422 kDa

MATIPIVIETTGRTERAYDIYSRLLRDRIILLGSAVDDYVANLICAQLLFLESEDPEKEIFMYINSPGGVVSAGLAIYDTMQYVMPPVSTLCLGQAASMGALLLCAGATGMRYALPHSRIMIHQPSGGYQGQATDIEIHAKETRRTRETLNEIMAKHTGQSMERIQVDTERDNFMSAEEAVAYGLIDKVLTSRERLEKKDAE

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.556 kDa

MPIGVPKVPFRSPGEEDAVWVDIYNRLHRERLLFLGQGVDSEISNQLVGLMVYLSMEDNTRDLYLFINSPGGWVIPGIAIYDAMQIVPPDVHTICMGLAASMGSFILVGGEFTKRLAFPHARVMIHQPASSFYEAQAGEFILEAEELLKLREILTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHGIVDLVAVENSADFV

clpP

ATP-dependent Clp protease proteolytic subunit

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.