Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

213 amino acids

MSRNSYIQQSSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSVYDKRQLAS

23.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make clpP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here