cho

Excinuclease cho

295 amino acids

Incises the DNA at the 3' side of a lesion during nucleotide excision repair. Incises the DNA farther away from the lesion than UvrC. Not able to incise the 5' site of a lesion. When a lesion remains because UvrC is not able to induce the 3' incision, Cho incises the DNA. Then UvrC makes the 5' incision. The combined action of Cho and UvrC broadens the substrate range of nucleotide excision repair (By similarity).

33.725 kDa

MVRRLTSPRLEFEAAAIYEYPEHLRSFLNDLPTRPGVYLFHGESDTMPLYIGKSVNIRSRVLSHLRTPDEAAMLRQSRRISWICTAGEIGALLLEARLIKEQQPLFNKRLRRNRQLCALQLNEKRVDVVYAKEVDFSRAPNLFGLFANRRAALQALQSIADEQKLCYGLLGLEPLSRGRACFRSALKRCAGACCGKESHEEHALRLRQSLERLRVVCWPWQGAVALKEQHPEMTQYHIIQNWLWLGAVNSLEEATTLIRTPAGFDHDGYKILCKPLLSGNYEITELDPANDQRAS

cho

Excinuclease cho

295 amino acids

Incises the DNA at the 3' side of a lesion during nucleotide excision repair. Incises the DNA farther away from the lesion than UvrC. Not able to incise the 5' site of a lesion. When a lesion remains because UvrC is not able to induce the 3' incision, Cho incises the DNA. Then UvrC makes the 5' incision. The combined action of Cho and UvrC broadens the substrate range of nucleotide excision repair (By similarity).

33.694 kDa

MVRRLTSPRLEFEAAAIYEYPEHLRSFLNDLPTRPGVYLFHGESDTMPLYIGKSINIRSRVLSHLRTPDEAAMLRQSRRISWICTAGEIGALLLEARLIKEQQPLFNKRLRRNRQLCALQLNEKRVDVVYAKEVDFSRAPNLFGLFANRRAALQALQTIADEQKLCYGLLGLEPLSRGRACFRSALKRCAGACCGKESHDDHALRLRQSLERLRVVCWPWKGAVALKEQHPEMTQYHIIQNWLWLGAVNSLKEATTLIRAPAGFDHDGYKILCKPLLSGNYEITELDPVNDQQAS

cho

Excinuclease cho

295 amino acids

Incises the DNA at the 3' side of a lesion during nucleotide excision repair. Incises the DNA farther away from the lesion than UvrC. Not able to incise the 5' site of a lesion. In vitro, the incision activity of Cho is UvrA and UvrB dependent. When a lesion remains because UvrC is not able to induce the 3' incision, Cho incises the DNA. Then UvrC makes the 5' incision. The combined action of Cho and UvrC broadens the substrate range of nucleotide excision repair.

33.739 kDa

MVRRLTSPRLEFEAAAIYEYPEHLRSFLNDLPTRPGVYLFHGESDTMPLYIGKSVNIRSRVLSHLRTPDEAAMLRQSRRISWICTAGEIGALLLEARLIKEQQPLFNKRLRRNRQLCALQLNEKRVDVVYAKEVDFSRAPNLFGLFANRRAALQALQTIADEQKLCYGLLGLEPLSRGRACFRSALKRCAGACCGKESHEEHALRLRQSLERLRVVCWPWQGAVALKEQHPEMTQYHIIQNWLWLGAVNSLEEATTLIRTPAGFDHDGYKILCKPLLSGNYEITELDPANDQRAS

cho

Excinuclease cho

295 amino acids

Incises the DNA at the 3' side of a lesion during nucleotide excision repair. Incises the DNA farther away from the lesion than UvrC. Not able to incise the 5' site of a lesion. When a lesion remains because UvrC is not able to induce the 3' incision, Cho incises the DNA. Then UvrC makes the 5' incision. The combined action of Cho and UvrC broadens the substrate range of nucleotide excision repair (By similarity).

33.706 kDa

MVRRLTSPRLEFEAAAIYEYPEHLHSFLNDLPTRPGVYLFHGESDTMPLYIGKSVNIRSRVLSHLRTPDEAAMLRQSRRISWICTAGEIGALLLEARLIKEQQPLFNKRLRRNRQLCALQLNEKRVDVVYAKEVDFSRAPNLFGLFANRRAALQALQSIADEQKLCYGLLGLEPLSRGRACFRSALKRCAGACCGKESHEEHALRLRQSLERLRVVCWPWQGAVALKEQHPEMTQYHIIQNWLWLGAVNSLEEATTLIRTPAGFDHDGYKILCKPLLSGNYEITELDPANDQRAS

cho

Excinuclease cho

293 amino acids

Incises the DNA at the 3' side of a lesion during nucleotide excision repair. Incises the DNA farther away from the lesion than UvrC. Not able to incise the 5' site of a lesion. When a lesion remains because UvrC is not able to induce the 3' incision, Cho incises the DNA. Then UvrC makes the 5' incision. The combined action of Cho and UvrC broadens the substrate range of nucleotide excision repair (By similarity).

33.333 kDa

MVRRQSAPRLEFEAAAIYEYPEHLRPFLSEAPALPGVYIFHSESDTLPLYIGKSVNIRSRVLSHLRTPDEAAMLRQARRISWICTAGEMGALLLEARLIKEQQPLFNKRLRRNRQLCSLQLSEQKIEVVSARSVDFSHEPNLFGLFANRRAALQSLQNLADEQKLCYGLLGLEPVSRGRACFRFALKRCAGACCGQETPQAHFLRLQASLERLRVVCWPWKGAIALKESRPQMTQFHIINNWLWLGAVPSLDEAATLVRTPAGFDQDGYKILCKPLMSGQYEIIELHTDCRQS

cho

Excinuclease cho

293 amino acids

Incises the DNA at the 3' side of a lesion during nucleotide excision repair. Incises the DNA farther away from the lesion than UvrC. Not able to incise the 5' site of a lesion. When a lesion remains because UvrC is not able to induce the 3' incision, Cho incises the DNA. Then UvrC makes the 5' incision. The combined action of Cho and UvrC broadens the substrate range of nucleotide excision repair (By similarity).

33.363 kDa

MVRRQSAPRLEFEAAAIYEYPEHLRPFLSEAPALPGVYIFHSESDTLPLYIGKSVNIRSRVLSHLRTPDEATMLRQARRISWICTAGEMGALLLEARLIKEQQPLFNKRLRRNRQLCSLQLSEQKIEVVSARSVDFSHEPNLFGLFANRRAALQSLQNLADEQKLCYGLLGLEPVSRGRACFRFALKRCAGACCGQETPQAHFLRLQASLERLRVVCWPWKGAIALKESRPQMTQFHIINNWLWLGAVPSLDEAATLVRTPAGFDQDGYKILCKPLMSGQYEIIELHTDCRQS