Description
Incises the DNA at the 3' side of a lesion during nucleotide excision repair. Incises the DNA farther away from the lesion than UvrC. Not able to incise the 5' site of a lesion. When a lesion remains because UvrC is not able to induce the 3' incision, Cho incises the DNA. Then UvrC makes the 5' incision. The combined action of Cho and UvrC broadens the substrate range of nucleotide excision repair (By similarity).
Sequence
MVRRQSAPRLEFEAAAIYEYPEHLRPFLSEAPALPGVYIFHSESDTLPLYIGKSVNIRSRVLSHLRTPDEAAMLRQARRISWICTAGEMGALLLEARLIKEQQPLFNKRLRRNRQLCSLQLSEQKIEVVSARSVDFSHEPNLFGLFANRRAALQSLQNLADEQKLCYGLLGLEPVSRGRACFRFALKRCAGACCGQETPQAHFLRLQASLERLRVVCWPWKGAIALKESRPQMTQFHIINNWLWLGAVPSLDEAATLVRTPAGFDQDGYKILCKPLMSGQYEIIELHTDCRQS
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service