Function
Secreted chitinase involved in the degradation of chitin, a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods). Plays a morphogenetic role during apical growth, cell division and differentiation (cell wall morphogenesis). May be involved in the degradation and further assimilation of phytopathogenic fungi, namely mycoparasitism, the major mechanism accounting for the antagonistic activity against phytopathogenic fungi displayed by Trichoderma.
Sequence
MPSLTALASLLALVPSALAGWNVNSKQNIAVYWGQNSANSQSTQQRLSFYCNDANINVIDIAFLNGITPPMTNFANAGDRCTPFSDNPWLLQCPEIEADIKTCQANGKTILLSLGGDSYTQGGWSSTGAAQSAADQVWAMFGPVQSGSSVHRPFGSAVVDGFDFDFEATTNNLAAFGAQLKSRTNAAGGKKYYFSAAPQCFFPDAAVGALINAVPMDWIQIQFYNNPCGVSGFTPGTSTQNNYNYQTWENWAKTSPNPNVKLLVGIPAGPGAGRGYVSGSQLTSVFQYSKGFSTFAGAMMWDMSQLYQNTGFETQVVNALR