Secreted chitinase involved in the degradation of chitin, a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods). Plays a morphogenetic role during apical growth, cell division and differentiation (cell wall morphogenesis). May be involved in the degradation and further assimilation of phytopathogenic fungi, namely mycoparasitism, the major mechanism accounting for the antagonistic activity against phytopathogenic fungi displayed by Trichoderma.

Belongs to the glycosyl hydrolase 18 family. Chitinase class III subfamily.

321 amino acids

MPSLTALASLLALVPSALAGWNVNSKQNIAVYWGQNSANSQSTQQRLSFYCNDANINVIDIAFLNGITPPMTNFANAGDRCTPFSDNPWLLQCPEIEADIKTCQANGKTILLSLGGDSYTQGGWSSTGAAQSAADQVWAMFGPVQSGSSVHRPFGSAVVDGFDFDFEATTNNLAAFGAQLKSRTNAAGGKKYYFSAAPQCFFPDAAVGALINAVPMDWIQIQFYNNPCGVSGFTPGTSTQNNYNYQTWENWAKTSPNPNVKLLVGIPAGPGAGRGYVSGSQLTSVFQYSKGFSTFAGAMMWDMSQLYQNTGFETQVVNALR

34.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make chit33 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here