chchd4-a

Mitochondrial intermembrane space import and assembly protein 40-A

139 amino acids

Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17 or MICU1. Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria.

15.666 kDa

MSYCRQEGKDKIIFVTKEDHETPSSAELIADDPNDPYEDQGLILPNGDINWNCPCLGGMASGPCGEQFKSAFSCFHYSQEEIKGSDCLDQFRGMQECMQKYPDLYPQEDDEEEAEKEKQNKEAEPSVTQSSDTKEESSS