Description
Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17 or MICU1. Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria.
Sequence
MSYCRQEGKDKIIFVTKEDHETPSSAELIADDPNDPYEDQGLILPNGDINWNCPCLGGMASGPCGEQFKSAFSCFHYSQEEIKGSDCLDQFRGMQECMQKYPDLYPQEDDEEEAEKEKQNKEAEPSVTQSSDTKEESSS
Simulated SDS-PAGE
![Western blot of chchd4-a recombinant protein](/recombinant/chchd4-a-1.png)
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service