cdhB2

Acetyl-CoA decarbonylase/synthase complex subunit epsilon 2

170 amino acids

Part of a complex that catalyzes the reversible cleavage of acetyl-CoA, allowing growth on acetate as sole source of carbon and energy. The alpha-epsilon subcomponent functions as a carbon monoxide dehydrogenase. The precise role of the epsilon subunit is unclear; it may have a stabilizing role within the alpha(2)epsilon(2) component and/or be involved in electron transfer to FAD during a potential FAD-mediated CO oxidation.

Belongs to the CdhB family.

18.427 kDa

MVDTTKNTKLFTSYGVSTSKTVAPEMAAKLISKAKRPLLMVGTLALDPEILDRVVKISKTANIPIAATGSSLAALADKDVDAKYINAHMLGFYLTDPNWPGLDGNGNYDMVISIGFKKFYINQVLSAAKNFSNVKAIAIERGYIQNATMSFGNLSKAEHYAALDELVDFL

cdhB2

Acetyl-CoA decarbonylase/synthase complex subunit epsilon 2

170 amino acids

Part of a complex that catalyzes the reversible cleavage of acetyl-CoA, allowing growth on acetate as sole source of carbon and energy. The alpha-epsilon subcomponent functions as a carbon monoxide dehydrogenase. The precise role of the epsilon subunit is unclear; it may have a stabilizing role within the alpha(2)epsilon(2) component and/or be involved in electron transfer to FAD during a potential FAD-mediated CO oxidation.

Belongs to the CdhB family.

18.564 kDa

MVDTTKNTKLFTSYGVKTSKAITTEVAAKLISKAKRPLFVVGTGVLDPELLDRAVKIAKAKNIPIAATGSSMPGFVDKDVNAKYINLHQLGFYLTDPDWPGLDGNGNYDTIILLGHKKYYINQVLSAVKNFSDVKSISIDRNYIQNATMSFGNLSKADHIAALDEVIDLL