Part of a complex that catalyzes the reversible cleavage of acetyl-CoA, allowing growth on acetate as sole source of carbon and energy. The alpha-epsilon subcomponent functions as a carbon monoxide dehydrogenase. The precise role of the epsilon subunit is unclear; it may have a stabilizing role within the alpha(2)epsilon(2) component and/or be involved in electron transfer to FAD during a potential FAD-mediated CO oxidation.

Belongs to the CdhB family.

170 amino acids

MVDTTKNTKLFTSYGVKTSKAITTEVAAKLISKAKRPLFVVGTGVLDPELLDRAVKIAKAKNIPIAATGSSMPGFVDKDVNAKYINLHQLGFYLTDPDWPGLDGNGNYDTIILLGHKKYYINQVLSAVKNFSDVKSISIDRNYIQNATMSFGNLSKADHIAALDEVIDLL

18.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cdhB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here