brlA

C2H2 type master regulator of conidiophore development brlA

433 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (By similarity). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity).

49.07 kDa

MRSHGQQISDRLTVEVDCHSLGPSECPSMTSSFSPLDSPTPTPTSLYSQGSMASPGWHEHPHYHHGVPMERRTSATPLRSAFRMADITSGDAMMNMPCGNMDRQDQMALPDYLPAYEENVDQLWIPQDMPKTYQEPQFPYHASMSQYNQMARNYYHRPQQAGYLPESASNPCLSRPIFTQPTERMPNSASMTNMLHWMPSHESLVPQTITPAQVQPFPSGPVTPPSSSYSDFPTNIPTFKSHTPSTPHRSVSMGTPSGSDTPVSRMSGHNDYQEEFQLSPVYREGMMQRHRQPSRKSSKKQLLRSNLSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDETSQDFDPDFRGQLTPDGRPIYGSKLEDSMPDCGELSVDGWDD

brlA

C2H2 type master regulator of conidiophore development brlA

433 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (PubMed:25530311). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity). Regulates genes involved in conidiogenesis (PubMed:25530311).

49.204 kDa

MRSHGQQISDRLTVEVDCHSLGPSDCPSMTSSFSPLDSPTPTPTSLYSQSSMASPVWHEHSHYHHGLPMERRTSATPLRSAFRMTDLTAGDGMMNMPCGHMDRQEQMPLPDYLPGYDDNVEQLWIPQEMPKTYQEPQFPYQASMPQYNQMARNYYHRPQQAGYLPESASNPCLSRPIFTQPMERMPNSASMTNMLHWMPSHESLVPQTITPAQVQPYPSGPVTPPSSAYSDFPTNIPTFKSHTPSTPHRSVSMGTPSGSDTPVSRISGHNDYQEEFQLSPVYREGMMQRHRQPSRKPSKKQLLRSNLSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDETSQDFDPDFRGQLTPDGRPIYGSKLEDSMPDCGELSVDGWDD

brlA

C2H2 type master regulator of conidiophore development brlA

433 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (By similarity). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity).

49.107 kDa

MRSHGQHISDRLTVEVDCHSLSSSECPSMTSGFSPLDSPTPTPTSLYSQGSMASPGWHDHPHYHHGVPMERRTSATPLRSAFRMADLTSSETMMGMPCGTMDRQEQMPLPDYLPGYDENVDQLWIPQDMPKTYHEHQFPYQASMPQYNQMARNYYHRPQQAGYLPESASNPCLSRPIFTQPTERMPNSASMSNMLHWMPSHESLVPQTITPAQVQPFPSGPVTPPSSSYSDFPTNIPTFKSHTPSTPHRSVSMGTPSGSDTPVSRMSGHNDYQEDFQLSPVYREGMMQRHRQPSRKSSKKQLLRSNLSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDETSQDFDPDFRGQLTPDGRPIYGSKLEDTMPDCGELSVDGWDD

brlA

C2H2 type master regulator of conidiophore development brlA

433 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (By similarity). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity). Is not required for penicillin V production (PubMed:21148688).

48.901 kDa

MRSHGQQISDRLTVEVDCHSLGPSECPSMTSSFSPLDSPTPTPTSLYSQGSMASPGWPEPSHYHHGLPMERRTSATPLRSAFRMADLTSGEGMMNMPCGNMDRQEQMPLPDYLPGYDENVDQLWIPQDMPKTYQEPQFPYQASMPQYNQMARNYYHRPQQAGYLPESASNPCLSRPIFTQSTERMPNSASMSNMLGWMPSHESLVPQTITPAQVQPFPSGPVTPPSSSYSDFPANIPTFKTHTPSTPHRSVSMGTPSGSDTPVSRMSGHNDYQEDFQLSPVYREGMMQRHRQPSRKSSKKQLLRSNLSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWIPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDETSQDFDPDFRGQLTPDGRPIYGSKLEDTMPDCGELSVDGWDD

brlA

C2H2 type master regulator of conidiophore development brlA

432 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (PubMed:8508769, PubMed:5366214, PubMed:2823119, PubMed:2655931, PubMed:2196567,PubMed:7704830). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (PubMed:2823119, PubMed:2655931, PubMed:2108321). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (PubMed:8417986). Controls the expression of the conidiophore-specific phenol oxidase ivoB (PubMed:1901560). Controls the expression of the hydrophobin rodA (PubMed:2065971). Mediates the developmental switch from the indeterminate, apical growth pattern of vegetative cells to the budding growth pattern of conidiophores (PubMed:3293800). Expression of brlA leads to activation of abaA, wetA and stuA, cessation of vegetative growth, cellular vacuolization and spore formation.

47.932 kDa

MRNQSSLSDRLTVEVDCSSLGSNECPSMTSSFSPLESPTPTPTSIYSQGSLESPGWHGAGSLPNNTYERTPGSASMRSAFRLAGMASTESLGLPYGSMEGQERMPMPDFLSGYDENIEQLWMPSEAPKSYDHVAQGLAYHQGMHQYPTMARNTNNNYRHQAAAYLPESTTNPCLSRSIFHQPERVPSSMSSSMSMNNMLPWMNLGDSIAPQTIAPSQVGPVTPPPSYTDFPTSLSAFKQHSPTTPIRSCSLGTGSGADTPLSRLSGGPCEYMDDFQPSPVYRDGFQRPHRVASRKMLRRQTSKQNLMLENLPQVIKQVQFKCKEPGCNGRFKRQEHLKRHMKSHSKEKPHVCWVPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDENSPDYDPEFRGQLTPDGRPIYGSKLDDPIPGAGDMSLDGWDE

brlA

C2H2 type master regulator of conidiophore development brlA

431 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (PubMed:24113825). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity). Regulates the expression levels of seven secondary metabolism gene clusters including a down-regulated cluster putatively involved in the biosynthesis of the mycotoxins roquefortine C and meleagrin (PubMed:24113825). Negatively regulates the expression of cellulase genes (PubMed:24113825).

48.585 kDa

MRTQGQQISDRLTVEVDCHSLGPADCPSMTSSFSPLESPTPTPTSLYSHGSLTSPSWHEAGHYHSLPMERRPSGTPLRNAFRVTDFPSADPMGMQVGTMERPDQLPVSSEYLSGYDDINDQLWIPHDSIPKTFEHPTFPYQAPMPQYHHTMGRNHYYRPQAHTAYLPESASNPCLSRPMFSRHDGLSHSASMSNMLPWMTAPESLAPQTITPQQAFPGAGPVTPPSSNYSDFPASLQTFKPHTPSTPVRSLSLGTPRSDTPQSRMSGHYDYSEEYPVSPVYRDGHLIRTHRQPSRKPSKKQLVRSNLSLEKLPPIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDETSPDYDPEFRGQLTPDGRPIYGSKLEDLADCDLSVDGWED

brlA

C2H2 type master regulator of conidiophore development brlA

426 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (PubMed:17030990). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity). Positively regulates expression of the gliotoxin biosynthetic gene cluster in actively growing vegetative cells, and likely bridges morphological and chemical development during the life-cycle (PubMed:26032501). Regulates (directly or indirectly) the ergot cluster genes (PubMed:18333504). Positively regulates expression of the fumiquinazoline C biosynthetic gene cluster (PubMed:24612080). Positively regulates expression of the melanin biosynthetic gene cluster (PubMed:24123270). Mediates repression of ribosomal protein gene expression in response to nitrogen depletion (PubMed:19028996).

47.477 kDa

MRSQGNMSDRLGVEVDCHSLGSNECPSMGSSFSPLESPTPTPTSIYSQGSLASPSWPENGSYPGHAYDRGTGSTPIRGHFRLASMPSHENMGLPPYSSLDGQDRMAVTDFLPSYDENADQFWLPSDVPKTYDHHVHGLPCPPSMHQYPPMLRSNYRHHPAPYFPESATNPCLSRPIFHHQPERLPPSLSMSHMMPWMGHTESIAPETIAPSQVAPVTPPPSYTDFSNSINTFKTHSPDTPIRSCSLGTVSGADTPLSRLSGGAGEYMDECHQSPIYRDASGVRLQRQPSRKMARKQPSKQSLSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDETSPDYNPDYRGPLTADGRPMPGGTLDESMPSREISMEWDE

brlA

C2H2 type master regulator of conidiophore development brlA

425 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (By similarity). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (PubMed:25629352). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity). Coordinates also the expression of carbohydrate-active enzymes and of the key effectors of cell wall remodeling during autolysis (PubMed:25629352).

47.419 kDa

MRSQGNMSDRLTIEVDCTSLGSNECPSMASSFSPMESPTPTPTSVYSQGSLASPTWHEGGSYPGQGYERHTGTTPMRSAFRLASMTSNDSMGMSYGQMEAQERMPMTDFLSGYDENVEHFWIPQEAQKAYEHGVPGLPYPQAMPQYSTMGRSSYRQHAAPYLPDSATNPCLSRSIFHQPERVPNSMSMGNVIPWMAPQPDSIAPQTIAPSQVAPVTPPPSYSEFSGSINTFKTHSPTTPVRSCSLGTTSGTDTPMSRLSGGMDYLDDFNQSPVYRDNLARVQRQPSRKVARKQSSKQSLSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCERAFSRSDNLNAHYTKTHSKRGGRNRYVATLDENSPDYNPEYRGQLTADGRPVYNSKSQDLMPDARETSEEAWLE

brlA

C2H2 type master regulator of conidiophore development brlA

421 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (By similarity). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity). Required for conidiophores formation (PubMed:17213655). Controls expression of abaA (PubMed:19850144).

46.826 kDa

MRTQNNLTVEVDCHSLGSNECPSMTSSFSPMDSPTPTPTSIYSQGSLASPGWQDAGSYPGHAYERHTGATPMRSAFRLAGMTSNENMGMSYGAMEAQERMPMPDFLSAYDDNVEHFWLPSDGPKTYETGTHSLPYPHTLPQCPPMVRSNYRPHAAYLPEAATNPCLSRSIFHHAERVPQSMSMGNMMPWIPQATESIAPQTIAPSQVGPVTPPPSYSEFPTSIQTFKTHSPTTPLRSCSIGTASGPDTPISRLSGGAADYLEDFQQSPPFRDGLNRLQRQPSRKMIRKQSSRQNMSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCERAFSRSDNLNAHYTKTHSKRGGRNRYVATLDESSPDYDPDFRGQLTPDGLPIRGSTLDDPMPNSREYSVDGLDD

brlA

C2H2 type master regulator of conidiophore development brlA

421 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (By similarity). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity).

46.925 kDa

MRAQNNLTVEVDCHSLGSNECPSMTSSFSPMDSPTPTPTSIYSQGSLASPGWQDAGSYPGHAYERHTGTTPMRSAFRLAGMTSNENMAMSYGAMEAQERMPMPDFLSAYDDNVEHFWLPSDAPKTYETGTHSLPYPHTLPQCPPMVRSNYRPHAAYLPEAATNPCLSRSIFHHAERVPQSMSMGNMMPWIPQASESIAPQTIAPSQVGPVTPPPSYSEFPTSIQTFKTHSPTTPLRSCSIGTASGPDTPISRMSGGAADYLEDFQQSPPFRDGLNRLQRHPSRKMIRKQSSRQNMSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCERAFSRSDNLNAHYTKTHSKRGGRNRYVATLDESSPDYDPDFRGQLTPDGRPIRGSTLDDPMPDTREYSVDGLDD

brlA

C2H2 type master regulator of conidiophore development brlA

376 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (PubMed:26283234). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity).

42.535 kDa

MEDGFGMYSHSMSCPSTASTSFSSASSSAYDPFTPSSRRSTPNELSLDLDGSCSYAAHQHSLELTPPTTSMAKYFMGQTIKQEPEQMSFGSLPTTPMKKVDGGFAAEYDLIDMNMASHHSMGTITPSNSFGLHTISPETAMGPTSYMMTPTQSLSGSEIAESSSSWSVTNESPINFFQQPKDLSFHDMDSLDLDERHHHHHNHHQHHHAQQSPMGQHFQLHSNTGASPNSMRVQRKMMLHEAQRKTSELQRAQIRESRKRAGKPESGAVDVVRRAMCKCDYPGCNKAFRRNEHLKRHKQTFHGEGPNRFSCEFCGKDQFNRQDNLNNHRKLHARPNSRNRGVEFIPEAVPIIEHEERSRKRRAPPKSKAEKRDYDF

BrlA

C2H2 type master regulator of conidiophore development BrlA

368 amino acids

BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation. They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (PubMed:29958281). BrlA, abaA and wetA act together to positively regulate the expression of the Pks1 gene cluster that mediates the biosynthesis of an anthraquinone derivative pigment that contributes to conidial pigmentation that provides protection from UV radiation, heat and cold stress (PubMed:29958281).

41.321 kDa

MQFESDFRFDMDDSFSMCSQTLPCPSAGSSFSSASSAYEPFTPTSRRSTPNELSLDFEGAYNPFATHHSELTSPSGHMSKYMFGGPVKGEPEHMSFNEALPTTPMKKLDGMVTPDYDHMLEMNLASRHSIGSITPSGSFPMYTISPTTMGPTSFMMTPTHSLSGSEIAESTSSWSCSNESPISFFPQRGLGPLELEGLDMDRHPQSPLGTYHLHAPPSPGRLRAHRKMMVHEIQRKTNELQRAQIRASRKVSGSKSDGGVDVVRRAMCKCDYPGCHKAFRRNEHLKRHKQTFHGEGPNRFSCEFCGKDQFNRQDNLNNHRKLHARPNSRNRGVEFIPAAVPIIEQEERSRKRRAPPKSKSADKRVDDY