BrlA, abaA and wetA are pivotal regulators of conidiophore development and conidium maturation (PubMed:17030990). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds promoters of target genes at brlA response elements (BREs) containing the conserved sequence 5'-(C/A)(A/G)AGGG(G/A)-3' (By similarity). Positively regulates expression of the gliotoxin biosynthetic gene cluster in actively growing vegetative cells, and likely bridges morphological and chemical development during the life-cycle (PubMed:26032501). Regulates (directly or indirectly) the ergot cluster genes (PubMed:18333504). Positively regulates expression of the fumiquinazoline C biosynthetic gene cluster (PubMed:24612080). Positively regulates expression of the melanin biosynthetic gene cluster (PubMed:24123270). Mediates repression of ribosomal protein gene expression in response to nitrogen depletion (PubMed:19028996).

426 amino acids

MRSQGNMSDRLGVEVDCHSLGSNECPSMGSSFSPLESPTPTPTSIYSQGSLASPSWPENGSYPGHAYDRGTGSTPIRGHFRLASMPSHENMGLPPYSSLDGQDRMAVTDFLPSYDENADQFWLPSDVPKTYDHHVHGLPCPPSMHQYPPMLRSNYRHHPAPYFPESATNPCLSRPIFHHQPERLPPSLSMSHMMPWMGHTESIAPETIAPSQVAPVTPPPSYTDFSNSINTFKTHSPDTPIRSCSLGTVSGADTPLSRLSGGAGEYMDECHQSPIYRDASGVRLQRQPSRKMARKQPSKQSLSLENLPSIIKQVQFKCKEPGCKGRFKRQEHLKRHMKSHSKEKPHVCWVPGCHRAFSRSDNLNAHYTKTHSKRGGRNRYVATLDETSPDYNPDYRGPLTADGRPMPGGTLDESMPSREISMEWDE

47.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make brlA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here