arg1

Probable acetylornithine aminotransferase, mitochondrial

441 amino acids

Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.

47.509 kDa

MFQRRSLLSVRSSGSQIAFRRFVSLTHKDPTPDTTSCNIIKKEGANIISVYARYPVVAAKGEGSYLFDKEGRKYIDFTSGVAVTSLGHAHPEVARLAADQCSKLVHSSNLFYNEPAIELSNVINNSLAKNSGIAGPTKIFFANCGTEANETALKFARKAAFEKYGEGKSQIVYFNNSFHGRSLGSLSITANPKYKRGFQPLLPDVVQAVYNDPASIEQFVNDKTAAVIVEPVQGEGGICPAKPEFLIALRKACDKVGASLIYDEIQCGLGRSGDLWAHSIVKDVASPDIITVAKPLANGLPIGATIVSSKIAAEIHPGEHGSTFGGNPVACRVGTFCVNELGSSKILQNVRKQHKALTSRFDDFVAKYPNLIRGYAGRGLLLGLQFTEPPAKFIELARQQGLLLLPGGNNNTRVLPSLNVKDEVIAKGLDIMESTLKALSK

ARG1

Argininosuccinate synthase

420 amino acids

Catalyzes the eighth step in arginine biosynthesis. Also has a catabolic function as the first enzyme of citrulline utilization as nitrogen source via arginine and the reactions involved in the arginase pathway.

Belongs to the argininosuccinate synthase family. Type 1 subfamily.

46.928 kDa

MSKGKVCLAYSGGLDTSVILAWLLDQGYEVVAFMANVGQEEDFDAAKEKALKIGACKFVCVDCREDFVKDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQIDVAKQEGCFAVSHGCTGKGNDQIRFELSFYALKPDVKCITPWRMPEFFERFAGRKDLLDYAAQKGIPVAQTKAKPWSTDENQAHISYEAGILEDPDTTPPKDMWKLIVDPMDAPDQPQDLTIDFERGLPVKLTYTDNKTSKEVSVTKPLDVFLAASNLARANGVGRIDIVEDRYINLKSRGCYEQAPLTVLRKAHVDLEGLTLDKEVRQLRDSFVTPNYSRLIYNGSYFTPECEYIRSMIQPSQNSVNGTVRVRLYKGNVIILGRSTKTEKLYDPTESSMDELTGFLPTDTTGFIAIQAIRIKKYGESKKTKGEELTL

ARG1

Omega-3 fatty acid desaturase, endoplasmic reticulum

380 amino acids

Microsomal (ER) omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes. It is thought to use cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and, possibly, other phospholipids.

Belongs to the fatty acid desaturase type 1 family.

43.996 kDa

MIQAQTLQHFGNGAREGDQSYFDPGAPPPFKIADIRAAIPKHCWEKSTLRSLSYVLRDVLVVTALAASAISFNSWFFWPLYWPAQGTMFWALFVLGHDCGHGSFSNSSKLNSFVGHILHSLILVPYNGWRISHRTHHQNHGHVEKDESWVPLTEKVYKNLDDMTRMLRYSFPFPIFAYPFYLWNRSPGKEGSHFNPYSNLFSPGERKGVVTSTLCWGIVLSVLLYLSLTIGPIFMLKLYGVPYLIFVMWLDFVTYLHHHGYTHKLPWYRGQEWSYLRGGLTTVDRDYGWINNVHHDIGTHVIHHLFPQIPHYHLVEATKSAKSVLGKYYREPQKSGPLPFHLLKYLLQSISQDHFVSDTGDIVYYQTDPKLHQDSWTKSK

arg1

Ornithine carbamoyltransferase, mitochondrial

361 amino acids

Belongs to the ATCase/OTCase family.

39.129 kDa

MIPTARCGALRQKIPVQAVRQYSSSTTLKTSPFAPRHLLSIADLTPTEFTTLVRNASSHKHSIKSGSIPTNLQGSLAGKTVAMMFSKRSTRTRISTEGATVQLGGHPMFLGKDDIQLGVNESLYDTAVVVSSMVSAIVARVGKHAEVADLAKHSTVPVINALCDSFHPLQAIADFQTIYETFTPKAHHLSSLGLEGLKIAWVGDANNVLFDMAISAAKMGVDLAVATPKGYEIPASMRELIQEAGKGVANPGKLIQTNVPEEAVKKADILVTDTWVSMGQEEESLKRMKAFEGFQITSELAKRGGANENWKFMHCLPRHPEEVSDEVFYSNRSLVFPEAENRLWAAISALEGFVVNKGKIA

arg1

Ornithine carbamoyltransferase, mitochondrial

361 amino acids

Belongs to the ATCase/OTCase family.

39.129 kDa

MIPTARCGALRQKIPVQAVRQYSSSTTLKTSPFAPRHLLSIADLTPTEFTTLVRNASSHKHSIKSGSIPTNLQGSLAGKTVAMMFSKRSTRTRISTEGATVQLGGHPMFLGKDDIQLGVNESLYDTAVVVSSMVSAIVARVGKHAEVADLAKHSTVPVINALCDSFHPLQAIADFQTIYETFTPKAHHLSSLGLEGLKIAWVGDANNVLFDMAISAAKMGVDLAVATPKGYEIPASMRELIQEAGKGVANPGKLIQTNVPEEAVKKADILVTDTWVSMGQEEESLKRMKAFEGFQITSELAKRGGANENWKFMHCLPRHPEEVSDEVFYSNRSLVFPEAENRLWAAISALEGFVVNKGKIA

ARG1

Arginase 1, mitochondrial

340 amino acids

Catalyzes the hydrolysis of L-arginine to urea and L-ornithine. The latter can be utilized in the urea cycle or as a precursor for the synthesis of both polyamines and proline (By similarity).

Belongs to the arginase family.

36.944 kDa

MGGVAAGTRWIHHVRRLSAAKVSADALERGQSRVIDASLTLIRERAKLKAELLRALGGVKASACLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELNDPRVLTDVGDVPIQEIRDCGVEDDRLMNVVSESVKTVMEEDPLRPLVLGGDHSISYPVVRAVSEKLGGPVDILHLDAHPDIYDAFEGNIYSHASSFARIMEGGYARRLLQVGIRSITKEGREQGKRFGVEQYEMRTFSKDREKLESLKLGEGVKGVYISVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQGDVVAGDVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK

Arg1

Arginase-1

323 amino acids

Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (By similarity). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (PubMed:27043409). Plays a role in the immune response of alternatively activated or M2 macrophages in processes such as wound healing and tissue regeneration, immune defense against multicellular pathogens and parasites, and immune suppression and allergic inflammation; the regulatory outcome seems to be organ specific (PubMed:7537672, PubMed:19360123, PubMed:20483789, PubMed:23552798, PubMed:23637937). In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs) plays a role in suppression of T cell-mediated antitumor immunity (PubMed:19414774, PubMed:23248265).

Belongs to the arginase family.

34.808 kDa

MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

Arg1

Arginase-1

323 amino acids

Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (By similarity). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival. Plays a role in the immune response of alternatively activated or M2 macrophages in processes such as wound healing and tissue regeneration, immune defense against multicellular pathogens and parasites, and immune suppression and allergic inflammation; the regulatory outcome seems to be organ specific. In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs) plays a role in suppression of T cell-mediated antitumor immunity.

Belongs to the arginase family.

34.973 kDa

MSSKPKPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYLKPPK

ARG1

Arginase-1

322 amino acids

Belongs to the arginase family.

35.009 kDa

MSSKPQSIGVIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKELECDVKDYGDLSFADNLDDSPFQIVKNPRCVGKASEKLADVVAEVKKTGRISLVLGGDHSLAIGSISGHARVHPDLCVIWVDAHTDINTPLTTKTGNLHGQPVSFLLKELKEKMPEVPGFYWVAPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVQGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTTVAITMACFGVAREGNHKPIDYLSPPK

ARG1

Arginase-1

322 amino acids

Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (PubMed:15546957, PubMed:16709924, PubMed:19380772). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (By similarity). In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure.

Belongs to the arginase family.

34.735 kDa

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

ARG1

Arginase-1

322 amino acids

Belongs to the arginase family.

35.018 kDa

MSFKSQSIGIIGAPFSKGQPRGGVEEGPTALRKAGLLEKLKEQECDVKDYGDLCFADVPNDTPFQIVKNPRSVGKANQQLADVVAEIKKNGRTSLVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTTTGNLHGQPVSFLLKELKEKIPEVPGLSWVTPCLSAKDIVYIGLRDVDPAEHYILKTLGIKYFSMIEVDKLGIGKVMEEAFSYLLGRKKRPIHLSFDVDGLDPFFTPATGTPVHGGLSYREGIYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVALVLACFGVAREGNHKPIDYLKPPK

ARG1

Arginase-1

322 amino acids

Belongs to the arginase family.

34.448 kDa

MSSKSKSIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQEHDVTDYGDLSFADVPNDSPFHIVKNPRAVGRANEQLAGAVAEIKKNGRISLVLGGDHSLAIGSISGHASVCPDLAVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIVKTLGIKYFSMTEVDKLGIGKVMEETLCYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVAGGLSYREGIYITEAIHKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVALTLASFGVAREGNHKPIDYLHPPK

arg1

Arginase-1

316 amino acids

Belongs to the arginase family.

34.566 kDa

MAKERHSVGVIGAPFSKGQPRRGVEEGPKYLREAGLIEKLREFGNDVRDCGDLDFPDVPNDTPFNNVKNPRTVGKATEILANAVTAVKKADKTCQSIGGDHSLAVGTIAGHAAVHPNLCVVWVDAHADINTPSTSPCGNLHGQPLSFLMKELKAKMPAVPGFEWVKPCLRSKDIVYIGLRDVDPGEHYILKTLGIKYLSMIEVDYLKDDKVMEETLEYLVGKHKRPIHLSFDIDGLDPSIAPATGTPCPGGRTYREGRILHEQLHKTGLLSGVDTIWMESTSRGETKRDVEVTVKTALDMTLSCFGKAREGFHAST