Protein expression services for ARG1 | Omega-3 fatty acid desaturase, endoplasmic reticulum
Description
Microsomal (ER) omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes. It is thought to use cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and, possibly, other phospholipids.
Family
Belongs to the fatty acid desaturase type 1 family.
Species
Vigna radiata var. radiata
Length
380 amino acids
Sequence
MIQAQTLQHFGNGAREGDQSYFDPGAPPPFKIADIRAAIPKHCWEKSTLRSLSYVLRDVLVVTALAASAISFNSWFFWPLYWPAQGTMFWALFVLGHDCGHGSFSNSSKLNSFVGHILHSLILVPYNGWRISHRTHHQNHGHVEKDESWVPLTEKVYKNLDDMTRMLRYSFPFPIFAYPFYLWNRSPGKEGSHFNPYSNLFSPGERKGVVTSTLCWGIVLSVLLYLSLTIGPIFMLKLYGVPYLIFVMWLDFVTYLHHHGYTHKLPWYRGQEWSYLRGGLTTVDRDYGWINNVHHDIGTHVIHHLFPQIPHYHLVEATKSAKSVLGKYYREPQKSGPLPFHLLKYLLQSISQDHFVSDTGDIVYYQTDPKLHQDSWTKSK
Mass
44 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ARG1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here