algG

Mannuronan C5-epimerase

543 amino acids

Catalyzes the epimerization of beta-D-mannuronate to alpha-L-guluronate during the synthesis of the linear polysaccharide alginate (PubMed:8144447, PubMed:15968068, PubMed:16866359). In addition, is part of a periplasmic protein complex that protects alginate from degradation by AlgL by channeling the newly formed alginate polymer through a scaffold that transfers the alginate polymer through the periplasmic space to the outer membrane secretin AlgE (PubMed:12581364, PubMed:15968068).

Belongs to the D-mannuronate C5-epimerase family.

59.802 kDa

MPDISLSIPRRRLPRLRPLAAAVLGAVLLHGQAWAAQPVEKPQPVPAQAGNEPGLTQGLKETGNYTVTTAPAEPLHLDPPKLPDLSGYTAAAVEAKIVRKPGGRASVQRMVQQQPLKEFTGGSNRLAEWVKRQRQMPQAIFIEGGYVNLAQLAGKLPASALEQVEPGVFVARLPIVVSQGATLDIDKQVKELRLSQERGAFLVNDGMLFVRDSKVTGWSESKKEPAWFKTPNEFRPFLISWGGAEVYLSNSTFTSFGYNASKAYGISISQYSPGMDKQMKRPRPKGWVIDSTIVDSWYGFYCYEADDLVVKGNTYRDNIVYGIDPHDRSHRLIIADNTVHGTRKKHGIIVSREVNDSFIFNNRSYENKLSGIVLDRNSEGNLVAYNEVYRNHSDGITLYESGDNLLWGNQVLANRRHGIRVRNSVNIRLYENLAAGNQLIGVYGHIKDLTNTDRNIALDPFDTKVSLIVVGGKLAGNGSGPLSVDSPLSLELYRVAMLAPTKSSGISLPGVLGEKQDQILDLLVRQDKAVLIDPVESQAELQD

algG

Mannuronan C5-epimerase

536 amino acids

Catalyzes the epimerization of beta-D-mannuronate to alpha-L-guluronate during the synthesis of the linear polysaccharide alginate (PubMed:24398681). In addition, is part of a periplasmic protein complex that protects alginate from degradation by AlgL by channeling the newly formed alginate polymer through a scaffold that transfers the alginate polymer through the periplasmic space to the outer membrane secretin AlgE (By similarity).

Belongs to the D-mannuronate C5-epimerase family.

59.486 kDa

MNSHASNGRSRNWPHALLESALLTSALLMASSVALANAPAVPEAPKALVKELHQAKTYTITSPPTGPLEMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLMPTKEVGISLNGILGERQDEILDLLVRQKKAVLIDPVESQTELRE

algG

Mannuronan C5-epimerase

529 amino acids

Catalyzes the epimerization of beta-D-mannuronate to alpha-L-guluronate during the synthesis of the linear polysaccharide alginate (PubMed:11707327). In addition, is part of a periplasmic protein complex that protects alginate from degradation by AlgL by channeling the newly formed alginate polymer through a scaffold that transfers the alginate polymer through the periplasmic space to the outer membrane secretin AlgE (PubMed:12775688).

Belongs to the D-mannuronate C5-epimerase family.

58.203 kDa

MGACAMNPQALKGSAMLAAAMLLASGAAMADVAPQAKAPTIAKELQQAKTYTISSPPTAPLEMAKPALPALSGYTDAAMEKKIVRAKPGKISIRRMMQEDALKDFIGGDNKMAEWVVRQHGIPQAIFIDDGYMNLKDLLGKVPKQYLSETSPGVFLAKLPIVVGRKGILEIDKKTQELRLSQEAGSFLINDGQLFVRDTKVTGWSEKANGPALYKSPKEFRPFLLAWGGTETYISNTKMASFGYANSKSYGVSISQYTPNMAKVLKRPEPTGWIIDSEFSDMWYGFYCYETTGFVIKGNTYKDNIVYGIDPHDRSHGLIIADNTVYGTKKKHGIIISREVNDSFIFNNRSYDNKLSGLVLDRNSVNNFVADNEFYRNHTDGITLYESGDNLLWGNKVIANRRHGIRVRNSVNIKLYENTSMANGLTGLYGHIKDLTDTDRDIALDPFDAKVSLIVVGGELAGNGSGPLSIDSPLSVELYRVSMLAPTKSSGISFNGVLGDRQEEILDLLVRQQKAVLIDPVERQTELQD

algG

Mannuronan C5-epimerase AlgG

525 amino acids

Catalyzes the epimerization of beta-D-mannuronate to alpha-L-guluronate during the synthesis of the linear polysaccharide alginate (PubMed:8830682). In addition, is part of a periplasmic protein complex that protects alginate from degradation by AlgL by channeling the newly formed alginate polymer through a scaffold that transfers the alginate polymer through the periplasmic space to the outer membrane secretin AlgE (By similarity).

Belongs to the D-mannuronate C5-epimerase family.

58.317 kDa

MNVQRKLASTQLKPVLLGVLLATSAWSQAAPPEQARQSAPPTLSSKQYSVTSASIEALKLDPPKLPDLSGYTHAAVEAKIRRKPGGRIAAAMLQQTALKDFTGGSGRLREWIVRQGGMPHAIFIEGGYVELGQLARQLPANQFAETTPGVYVARVPIVVAPGATLHIGKNVKELRLSEERGAFLVNDGKLFITDTKLVGWSEKNNAPSAYRGPESFWAFLVSWGGTETYISRRPVASLGYNTSKAYGVSITQYTPEMHKRLKRPRPTGWLIDSVFEDIYYGFYCYEADDVVLKGNTYRDNIIYGIDPHDRSERLVIAENHVYGTKKKHGIIVSREVNNSWIINNRTHDNKLSGIVLDRNSEHNLVAYNEVYQNHSDGITLYESSNNLIWGNRLINNARHGIRMRNSVNIRIYENLSVVNQLTGIYGHIKDLSSTDRDFKLDPFDTKVSMIVVGGQLTGNGSSPISVDSPLSLELYRVEMLAPTKSSGLTFTGILEDKQEEILDLLVRRQKAVLIDPVVDLAQAEL

algG

Mannuronan C5-epimerase

519 amino acids

Catalyzes the epimerization of beta-D-mannuronate to alpha-L-guluronate during the synthesis of the linear polysaccharide alginate. In addition, is part of a periplasmic protein complex that protects alginate from degradation by AlgL by channeling the newly formed alginate polymer through a scaffold that transfers the alginate polymer through the periplasmic space to the outer membrane secretin AlgE.

Belongs to the D-mannuronate C5-epimerase family.

57.936 kDa

MNLHPHLRHSLLASALLLASGLATAAEPQVIAKELQQAKTYTVASAPIEPLQMDPPKLPDLTGFTAEAVQKKIDRRHKGKVSLRRMFQEDTLKEFVGGDNKAAEWVQRQHGIPQAIFVDDGHVDLTELSKKVPKQYFSEVEPGVYLARLPIVVGQKGILEIDGKVKQLRLSQEGGAFLVNDGKLFVTDTQVTGWREKDNGPATFRSPKEFRPFLLSWGGTETYIVNTKMASFGYAKSKSYGVSISQYTPNMAKRMGRPEPTGWIIGSEFSDMWYGFYCYETQDFVIKDSTYRDNIVYGIDPHDRSHRLIIAGNTVYGTKKKHGIIVSREVNDSWIINNKSYDNKLSGVVIDRNSVNNLVAYNEIYRNHTDGITLYESGDNLIWGNKLVNNRRHGIRVRNSVNIRLYENVAMANGLVGVYGHIKDLSDTDRDIALDPFDTKVSLIVVGGELSANGSGPLSIDSPLSVELYKVSMLAPRKASGISLNGVLGERQDEILDLLVRQQKAVLIDPVERQTEMID