Catalyzes the epimerization of beta-D-mannuronate to alpha-L-guluronate during the synthesis of the linear polysaccharide alginate (PubMed:8144447, PubMed:15968068, PubMed:16866359). In addition, is part of a periplasmic protein complex that protects alginate from degradation by AlgL by channeling the newly formed alginate polymer through a scaffold that transfers the alginate polymer through the periplasmic space to the outer membrane secretin AlgE (PubMed:12581364, PubMed:15968068).

Belongs to the D-mannuronate C5-epimerase family.

543 amino acids

MPDISLSIPRRRLPRLRPLAAAVLGAVLLHGQAWAAQPVEKPQPVPAQAGNEPGLTQGLKETGNYTVTTAPAEPLHLDPPKLPDLSGYTAAAVEAKIVRKPGGRASVQRMVQQQPLKEFTGGSNRLAEWVKRQRQMPQAIFIEGGYVNLAQLAGKLPASALEQVEPGVFVARLPIVVSQGATLDIDKQVKELRLSQERGAFLVNDGMLFVRDSKVTGWSESKKEPAWFKTPNEFRPFLISWGGAEVYLSNSTFTSFGYNASKAYGISISQYSPGMDKQMKRPRPKGWVIDSTIVDSWYGFYCYEADDLVVKGNTYRDNIVYGIDPHDRSHRLIIADNTVHGTRKKHGIIVSREVNDSFIFNNRSYENKLSGIVLDRNSEGNLVAYNEVYRNHSDGITLYESGDNLLWGNQVLANRRHGIRVRNSVNIRLYENLAAGNQLIGVYGHIKDLTNTDRNIALDPFDTKVSLIVVGGKLAGNGSGPLSVDSPLSLELYRVAMLAPTKSSGISLPGVLGEKQDQILDLLVRQDKAVLIDPVESQAELQD

59.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make algG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here