albA

Antilisterial bacteriocin subtilosin biosynthesis protein AlbA

448 amino acids

Catalyzes the formation of 3 thioether bonds during production of the sactipeptide subtilosin from SboA. In vitro the thioether bonds cannot be made in the absence of the SboA propeptide, suggesting this is the first reaction in subtilosin maturation (PubMed:22366720). In vitro, in the absence of a second substrate, cleaves S-adenosyl-L-methionine into Met and 5'-dA (PubMed:22366720).

51.514 kDa

MFIEQMFPFINESVRVHQLPEGGVLEIDYLRDNVSISDFEYLDLNKTAYELCMRMDGQKTAEQILAEQCAVYDESPEDHKDWYYDMLNMLQNKQVIQLGNRASRHTITTSGSNEFPMPLHATFELTHRCNLKCAHCYLESSPEALGTVSIEQFKKTADMLFDNGVLTCEITGGEIFVHPNANEILDYVCKKFKKVAVLTNGTLMRKESLELLKTYKQKIIVGISLDSVNSEVHDSFRGRKGSFAQTCKTIKLLSDHGIFVRVAMSVFEKNMWEIHDMAQKVRDLGAKAFSYNWVDDFGRGRDIVHPTKDAEQHRKFMEYEQHVIDEFKDLIPIIPYERKRAANCGAGWKSIVISPFGEVRPCALFPKEFSLGNIFHDSYESIFNSPLVHKLWQAQAPRFSEHCMKDKCPFSGYCGGCYLKGLNSNKYHRKNICSWAKNEQLEDVVQLI

albA

Albonoursin synthase

219 amino acids

Involved in the biosynthesis of albonoursin (cyclo[(alpha,beta-dehydro-Phe)-(alpha,beta-dehydro-Leu)]), an antibacterial peptide. Catalyzes the formation of alpha,beta-dehydro-Phe (DPhe) and alpha,beta-dehydro-Leu (DLeu) residues during the biosynthesis of albonoursin. The catalytic reaction of cyclo(L-Phe-L-Leu) occurs in a two-step sequential alpha-beta-dehydrogenation leading first to cyclo(alpha,beta-dehydro-Phe-L-Leu) and finally to albonoursin. Can also use cyclo(L-Phe-L-His), cyclo(L-Trp-L-Trp), cyclo(L-Leu-L-Ala), cyclo(L-Phe-Gly), cyclo(L-Leu-Gly), cyclo(L-Ser-Gly) and cyclo(L-Glu-Gly) as substrate suggesting that the diketopiperazine ring is essential for the enzymatic reaction.

Belongs to the nitroreductase family.

23.763 kDa

MRRHPSHSPYRGGCEVRPKRRGLMLAHSSSESPPESLPDAWTVLKTRTAVRNYAKEPVDDALIEQLLEAMLAAPTASNRQAWSFMVVRRPAAVRRLRAFSPGVLGTPAFFVVACVDRSLTDNLSPKLSQKIYDTSKLCVAMAVENLLLAAHAAGLGGCPVGSFRSDIVTSMLGIPEHIEPMLVVPIGRPATALVPSQRRAKNEVVNYESWGNRAAAPTA

albA

DNA/RNA-binding protein Alba

98 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.525 kDa

MSGTSPTPSNVVLVGKKPVMNYVLAALTLLNQGVPEIIIKARGRAISKAVDTVEIVRNRFLPDKIEIRAIGVGSQVVTSQDGRQSRVSTIEISIKKKA

albA

DNA/RNA-binding protein Alba

97 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.503 kDa

MSSGATPSNVVLVGKKPVMNYVLAALTLLNQGVSEITIKARGRAISKAVDTVEIVRNRFLPDKIEVKEIRIGSQVVTSQDGRQSRVSTIEIGIRKKA

albA

DNA/RNA-binding protein Alba

97 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.711 kDa

MAAQIPQSNEVRVGKKPVMNYVLATLTLLNQGVDRIEIKARGRAISKAVDTVEIVRNRFLPGQVRVAEIRIGSQTVTSADGRQSRISTIDIVLERVK

albA

DNA/RNA-binding protein Alba

96 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.715 kDa

MPEDNVIFVGNKPVMNYVLAAVTQFNEGAKEVTIKARGRAISRAVDTAEVVRHRFLTDVEIDRIQISTEELASEKGEKINVSSIEIFLKRPRAATD

albA

DNA/RNA-binding protein Alba

95 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.305 kDa

MSTEARDTIFIGKKPLMAYVTSTLIQLANIPSVNIKARGLSIGRAVDVAQIIARKTENAGYSIGEIKIGSESLESQDGRTRNVSTIEIEVKRNQA

albA

DNA/RNA-binding protein Alba

93 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.352 kDa

MTEEHVVYIGKKPVMNYVLAVITQFHEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDDVDVKEIKIGTEELPTADGRTTNTSTIEIVLARKA

albA

DNA/RNA-binding protein Alba

93 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.385 kDa

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

albA

DNA/RNA-binding protein Alba

93 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.382 kDa

MTEEHVVYIGKKPVMNYVLAVITQFHEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDDVDVKEIKIGTEELPTADGRTTNTSTIEIVLARKT

albA

DNA/RNA-binding protein Alba

92 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.995 kDa

MNKDNTVFVGNKPVMNYVLAVVTQFSNGATEVIIKARGKAISRAVDTGEIALNRFLEGVRKKEIITSTEEIETDSGKTNVSSIEIVLTNVPL

albA

DNA/RNA-binding protein Alba

92 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.827 kDa

MATEQTILVGKKPTTNYVIATVMAFNAGVKKVVLKARGAAISKAVSTAVMVRDRFLPGKVQIKDIKLLSDKVQGQGGRERTVAAIEVVLEMA

albA

DNA/RNA-binding protein Alba

92 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.883 kDa

MATEQTILVGKKPTTNYVIATVMAFNAGIKRVVLKARGAAISKAVSTAVMVRDRFLPGKVQIRDVKLLSDKVQGQGGRERTVAAVEIVLEMA

albA

DNA/RNA-binding protein Alba

92 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.827 kDa

MATEQTILVGKKPTTNYVIATVMAFNAGVKKVVLKARGAAISKAVSTAVMVRDRFLPGKVQIKDIKLLSDKVQGQGGRERTVAAVEIVLEMA

albA

DNA/RNA-binding protein Alba

92 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.811 kDa

MATEQTILVGKKPATNYVIATVMAFNAGVKRVVLKARGAAISKAVSTAVMVRDRFLPGKVQIKDIKVLSDKVQGQGGRERTVAAVEIVLEMA

albA

DNA/RNA-binding protein Alba

91 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes (By similarity). Incubation with DNA in vitro gives fibrous structures 10.3 +/- 1.1 nm in thickness (naked DNA is 1.83 +/- 0.37 nm). This protein does not significantly compact DNA (PubMed:21148291).

Belongs to the histone-like Alba family.

10.148 kDa

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIRARGRAISRAVDVAEIVRNRFLPEVRVKEIKIGTEELPTADGRTANTSTIEIILEKP

albA

DNA/RNA-binding protein Alba

91 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.106 kDa

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSVKARGRAISRAVDVAEIVRNRFLPEVRVKEIKIGTEELPTADGRTANTSTIEIILEKP

albA

DNA/RNA-binding protein Alba

91 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.928 kDa

MIKDNTVFVGNKPVMNYVLAVVTQFNNGAEEVAIKARGKAISRAVDTAEIALNRFLANVDKKEIFTSTEMIDTDTGKTNVSSIEIVLTHAK

albA

DNA/RNA-binding protein Alba

91 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.975 kDa

MSEENVVYIGNKPVMNYVLAVVTQMNGGTSEVILKARGIAISRAVDVAEIVRNRFIPDIQIENIDICTEEIIGNEGTATNVSAIEIQLRKD

albA

DNA/RNA-binding protein Alba

90 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.795 kDa

MAEENIVYIGNKPVMNYVLAVVTQMNSGVTEVILKARGRAISRAVDVAEIVRNRFISDVDVKSIDISTEEIVGNEGTSSNVSAIEIRLSK

albA

DNA/RNA-binding protein Alba

90 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.015 kDa

MPEVFIGKKPLTNYVMAVVMQFMQGANEVVIKARGRNISRAVDVAERVRKRFLAGQVDVGDIKIDSEEVVDPATGQKRTVSTIEIKLVKK

albA

DNA/RNA-binding protein Alba

90 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.056 kDa

MAEENVIFVGKKPTMNYVLAIVTQFNNNSTSRIVIKARGKAISKAVDIAEITRHKFIQDAKYDEIKLDTESLQGEKGESNVSSIEIVLTR

albA

DNA/RNA-binding protein Alba

89 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.938 kDa

MAEENIIFVGKKPTMNYVLAVVTQFNNNANKIIIKARGKTISKAVDVAEITRHKFIPDAKYEEIKLDTETLQGERGSSNVSSIEITLSR

albA

DNA/RNA-binding protein Alba

89 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.966 kDa

MAEENIIFVGKKPTMNYVLAVVTQFNNNANKIIIKARGKTISKAVDVAEITRHKFIPDAKYEEIRLDTETLQGERGSSNVSSIEITLSR

albA

DNA/RNA-binding protein Alba

89 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.94 kDa

MDNIVYVGNKGVMNYVLAVITQFNSENAQEVIVKARGKAISRAVDVEEMVTKRFMPEVKIKEINLGTDHIQGEDGKSINVSTIEIILFK

albA

DNA/RNA-binding protein Alba

89 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.668 kDa

MAEDDVVFVGNKPVMNYVLAVVTQFNSGAKEVRIMARGRAISRAVDVAEVSRSRFLGDVVVKDIKISTETLNTDRGETNVSAIEIVLGK

albA

DNA/RNA-binding protein Alba

87 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

9.675 kDa

MDNVVLIGKKPVMNYVVAVLTQLTSNDEVIIKARGKAINKAVDVAEMIRNRFIKDIKIKKIEIGTDKVKNPDGREVNVSTIEIVLAK