Involved in the biosynthesis of albonoursin (cyclo[(alpha,beta-dehydro-Phe)-(alpha,beta-dehydro-Leu)]), an antibacterial peptide. Catalyzes the formation of alpha,beta-dehydro-Phe (DPhe) and alpha,beta-dehydro-Leu (DLeu) residues during the biosynthesis of albonoursin. The catalytic reaction of cyclo(L-Phe-L-Leu) occurs in a two-step sequential alpha-beta-dehydrogenation leading first to cyclo(alpha,beta-dehydro-Phe-L-Leu) and finally to albonoursin. Can also use cyclo(L-Phe-L-His), cyclo(L-Trp-L-Trp), cyclo(L-Leu-L-Ala), cyclo(L-Phe-Gly), cyclo(L-Leu-Gly), cyclo(L-Ser-Gly) and cyclo(L-Glu-Gly) as substrate suggesting that the diketopiperazine ring is essential for the enzymatic reaction.

Belongs to the nitroreductase family.

219 amino acids

MRRHPSHSPYRGGCEVRPKRRGLMLAHSSSESPPESLPDAWTVLKTRTAVRNYAKEPVDDALIEQLLEAMLAAPTASNRQAWSFMVVRRPAAVRRLRAFSPGVLGTPAFFVVACVDRSLTDNLSPKLSQKIYDTSKLCVAMAVENLLLAAHAAGLGGCPVGSFRSDIVTSMLGIPEHIEPMLVVPIGRPATALVPSQRRAKNEVVNYESWGNRAAAPTA

23.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make albA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here