AIDA

Axin interactor, dorsalization-associated protein

306 amino acids

Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling (By similarity).

Belongs to the AIDA family.

35.023 kDa

MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE

AIDA

Axin interactor, dorsalization-associated protein

306 amino acids

Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling (By similarity).

Belongs to the AIDA family.

35.023 kDa

MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE

Aida

Axin interactor, dorsalization-associated protein

305 amino acids

Acts as a ventralizing factor during embryogenesis (By similarity). Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling.

Belongs to the AIDA family.

34.888 kDa

MSEVTRSLLQRWGASLRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPIPLRRILAPGEEENLEFEEDEEGGAGAGPPDSFSARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVERLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQSLHKE

aidA

Quorum-quenching protein AidA

304 amino acids

Involved in quorum quenching (QQ). Inhibits motility and biofilm formation. Could contribute in bacterial competition, as it is capable of hydrolyzing the signaling molecules that mediate interspecies communication.

Belongs to the AB hydrolase superfamily.

33.365 kDa

MGKSLNNVPQAPLDVQFDSNDVKCSAYLYRPTTEVATPMIVMAHGLGGTRRMRLTAFAERFVAEGYACLVFDYRYFGDSEGQPRQLLDIKSQLEDWKAAIAYARSLDKIDPNRVVIWGTSFGGGHVLATAANDNRLAAVISQCPFTDGFSSSMAMNPITTLKLMGLALKDKIGSILGAKPVMVPLAAPSGHTALMNAPDAYSGYLALMPSGSNIPNYVAARFVLDIIRYYPGRKTSRIQAPVLFCVCDTDSVAPSKTTLRHASHTPNHEIKHYADGHFEIYVGEAFERVVRDQIDFLKRIVPVK

aida

Axin interactor, dorsalization-associated protein

303 amino acids

Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by axin/JNK-signaling.

Belongs to the AIDA family.

34.56 kDa

MSDVNKTVQKWHASFKKGTDFDSWGQLVEAIDEYQILARQLQKEVQSSNSHDFTEEQKKTLGKFATCLEMRSAALQCTQSQEEFKLEDLKKLEPIIKNILTYNKDFPFDVQPVPLRKILAPGEEENLDVEEDLDAGTGAGSTPSFTSRLPGSLLPRLPSEPGMTLLTLTIEKIGLKDAGQCIDPYITVSVKDLNGIDLNPVQDTPVATRKEDTYIHFSVDVEIQRHLEKLPKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLNLLTKKPLYLHLNQTLHKD

AIDA

Axin interactor, dorsalization-associated protein

275 amino acids

Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling (By similarity).

Belongs to the AIDA family.

31.494 kDa

MFSSYRLARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE