Involved in quorum quenching (QQ). Inhibits motility and biofilm formation. Could contribute in bacterial competition, as it is capable of hydrolyzing the signaling molecules that mediate interspecies communication.

Belongs to the AB hydrolase superfamily.

304 amino acids

MGKSLNNVPQAPLDVQFDSNDVKCSAYLYRPTTEVATPMIVMAHGLGGTRRMRLTAFAERFVAEGYACLVFDYRYFGDSEGQPRQLLDIKSQLEDWKAAIAYARSLDKIDPNRVVIWGTSFGGGHVLATAANDNRLAAVISQCPFTDGFSSSMAMNPITTLKLMGLALKDKIGSILGAKPVMVPLAAPSGHTALMNAPDAYSGYLALMPSGSNIPNYVAARFVLDIIRYYPGRKTSRIQAPVLFCVCDTDSVAPSKTTLRHASHTPNHEIKHYADGHFEIYVGEAFERVVRDQIDFLKRIVPVK

33.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aidA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here