aglG

Alpha-glucoside transport system permease protein AglG

380 amino acids

Part of the binding-protein-dependent transport system for alpha-glucosides such as sucrose, maltose and trehalose. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the binding-protein-dependent transport system permease family. MalFG subfamily.

41.127 kDa

MNPSRRSPLTWAVHLSVLLLVLLWTLPTAGLLISSLRDKDQLAVSGWWTALSSSSRNAVVRAPSAEDQVERDGKFVISGNLLEGRGEVSAFGFSSREPTKFKPGETAELNDGERLTVQSDGSFEIVSDQRMEGSRGQRIFFTATTPPRFTLDNYAEVLSAAGIGRSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVLLAVVVGLLVVPLQMSLIPLLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVDGASDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGDDKLVLTGRLVNLLGSRGGNWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKGG

aglG

Glucosyl-dolichyl phosphate glucuronosyltransferase

313 amino acids

Involved in the protein N-glycosylation pathway responsible for the assembly and attachment of an N-linked pentasaccharide that decorates the S-layer glycoprotein and flagellins (PubMed:18631242, PubMed:21091511, PubMed:22730124). Catalyzes the transfer of a glucuronate residue (GlcA) to a glucose residue already bound to a dolichol phosphate (DolP), a compound that serves as a glycan lipid carrier in Archaea. In vitro, is able to add GlcA to DolP-Glc in which the omega-position isoprene is not saturated. However, the likely physiological lipid substrate is alpha,omega-saturated (PubMed:28809486).

Belongs to the glycosyltransferase 2 family.

35.802 kDa

MKVSVVVCTYSMERYESFSETVESVLAQTYEPLELVIVVDGNEEEFDRVQDDFGDIDDVVLHCNDENRGISYSRTKGAELGTGDVVAMIDDDATAEPDWIETLVDTYENNPDAVAVGGTVVPDWVARKPEFFPEEFYWLVGCDERGFGEHMEEVRNTYGSNISFKRDVFLEVGGYDTNTGRKGDKHVQAHEAPVCIRIYEQTGERVIYNKQARVNHKLFEYRTEFDWLVFRSFWQGYSKRVMDLLYPQASDDKNAYLKDLMLVYVVDRLKNLVEDPSLAQVQQLIAIFVFTAAVGFGYVYGLLTPNLVEKTNN