Involved in the protein N-glycosylation pathway responsible for the assembly and attachment of an N-linked pentasaccharide that decorates the S-layer glycoprotein and flagellins (PubMed:18631242, PubMed:21091511, PubMed:22730124). Catalyzes the transfer of a glucuronate residue (GlcA) to a glucose residue already bound to a dolichol phosphate (DolP), a compound that serves as a glycan lipid carrier in Archaea. In vitro, is able to add GlcA to DolP-Glc in which the omega-position isoprene is not saturated. However, the likely physiological lipid substrate is alpha,omega-saturated (PubMed:28809486).

Belongs to the glycosyltransferase 2 family.

313 amino acids

MKVSVVVCTYSMERYESFSETVESVLAQTYEPLELVIVVDGNEEEFDRVQDDFGDIDDVVLHCNDENRGISYSRTKGAELGTGDVVAMIDDDATAEPDWIETLVDTYENNPDAVAVGGTVVPDWVARKPEFFPEEFYWLVGCDERGFGEHMEEVRNTYGSNISFKRDVFLEVGGYDTNTGRKGDKHVQAHEAPVCIRIYEQTGERVIYNKQARVNHKLFEYRTEFDWLVFRSFWQGYSKRVMDLLYPQASDDKNAYLKDLMLVYVVDRLKNLVEDPSLAQVQQLIAIFVFTAAVGFGYVYGLLTPNLVEKTNN

35.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aglG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here