aftC

Alpha-(1->3)-arabinofuranosyltransferase

433 amino acids

Involved in the biosynthesis of the arabinogalactan (AG) region of the mycolylarabinogalactan-peptidoglycan (mAGP) complex, an essential component of the mycobacterial cell wall. Catalyzes the addition of an arabinofuranosyl (Araf) residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol (DPA) on the C-3 of an alpha-(1->5)-linked Araf from the arabinan backbone of AG.

48.915 kDa

MYGALVTAADSIRTGLGASLLAGFRPRTGAPSTATILRSALWPAAVLSVLHRSIVLTTNGNITDDFKPVYRAVLNFRRGWDIYNEHFDYVDPHYLYPPGGTLLMAPFGYLPFAPSRYLFISINTAAILVAAYLLLRMFNFTLTSVAAPALILAMFATETVTNTLVFTNINGCILLLEVLFLRWLLDGRASRQWCGGLAIGLTLVLKPLLGPLLLLPLLNRQWRALVAAVVVPVVVNVAALPLVSDPMSFFTRTLPYILGTRDYFNSSILGNGVYFGLPTWLILFLRILFTAITFGALWLLYRYYRTGDPLFWFTTSSGVLLLWSWLVMSLAQGYYSMMLFPFLMTVVLPNSVIRNWPAWLGVYGFMTLDRWLLFNWMRWGRALEYLKITYGWSLLLIVTFTVLYFRYLDAKADNRLDGGIDPAWLTPEREGQR

aftC

Alpha-(1->3)-arabinofuranosyltransferase

433 amino acids

Involved in the biosynthesis of the arabinogalactan (AG) region of the mycolylarabinogalactan-peptidoglycan (mAGP) complex, an essential component of the mycobacterial cell wall. Catalyzes the addition of an arabinofuranosyl (Araf) residue from the sugar donor decaprenyl-phospho-arabinose (DPA) on the C-3 of an alpha-(1->5)-linked Araf from the arabinan backbone of AG. It can also use (Z,Z)-farnesylphosphoryl D-arabinose (Z-FPA), and to a lesser extent (E,E,Z,Z,Z,Z)-heptaprenylphosphoryl D-arabinose (Z-HPA) and (Z)-nerylphosphoryl D-arabinose (Z-NPA) as sugar donors.

48.915 kDa

MYGALVTAADSIRTGLGASLLAGFRPRTGAPSTATILRSALWPAAVLSVLHRSIVLTTNGNITDDFKPVYRAVLNFRRGWDIYNEHFDYVDPHYLYPPGGTLLMAPFGYLPFAPSRYLFISINTAAILVAAYLLLRMFNFTLTSVAAPALILAMFATETVTNTLVFTNINGCILLLEVLFLRWLLDGRASRQWCGGLAIGLTLVLKPLLGPLLLLPLLNRQWRALVAAVVVPVVVNVAALPLVSDPMSFFTRTLPYILGTRDYFNSSILGNGVYFGLPTWLILFLRILFTAITFGALWLLYRYYRTGDPLFWFTTSSGVLLLWSWLVMSLAQGYYSMMLFPFLMTVVLPNSVIRNWPAWLGVYGFMTLDRWLLFNWMRWGRALEYLKITYGWSLLLIVTFTVLYFRYLDAKADNRLDGGIDPAWLTPEREGQR

aftC

Alpha-(1->3)-arabinofuranosyltransferase

430 amino acids

Involved in the biosynthesis of the arabinogalactan (AG) region of the mycolylarabinogalactan-peptidoglycan (mAGP) complex, an essential component of the mycobacterial cell wall. Catalyzes the addition of an arabinofuranosyl (Araf) residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol (DPA) on the C-3 of an alpha-(1->5)-linked Araf from the arabinan backbone of AG.

Belongs to the glycosyltransferase 87 family.

48.768 kDa

MYCALVTATDSITTKLLNAFRPRTSAPSTATVLRSVLWPIAILSVIHRSYVLGTNGYITDDFGPVYRAVINFKLGLDIYNEQFDHVDPHYLYPPGGTLLLAPFGYLPVDASRYWYISFNVLAFLIAAYLMLRIFDYTLSSVAAPALVLAMFCTESVTNTLVFTNINGCMLLGAVLFFRWLLKGGRNAELLAGAAIGLTLVVKPSLAPLLLLPVLNRQFYTLITAFGVPLVFNIAAWPLVPDPMNFVRHTVPYIMSTRDYFNSSIVGNGIYYGLPMWLILLLRVVFLLLAVGSLWLLYRYYRERDPRFWLLTSSGVLLTASFLLLSLGQGYYSTMLFPFLMTVVLPNSVLRNWPAWLAIYGFMTMDRWLLGHWPTTGRFLEYMKITYGWSLMLVVVFCVLYFRYLDAKQDGRLDQGIDPPWMARERTPAPV

aftC

Alpha-(1->3)-arabinofuranosyltransferase

279 amino acids

Involved in the biosynthesis of the arabinogalactan (AG) region of the mycolylarabinogalactan-peptidoglycan (mAGP) complex, an essential component of the mycobacterial cell wall. Catalyzes the addition of an arabinofuranosyl (Araf) residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol (DPA) on the C-3 of an alpha-(1->5)-linked Araf from the arabinan backbone of AG.

Belongs to the glycosyltransferase 87 family.

29.952 kDa

MLVQSRTLVTAILSCSLVFGTTVNGASVAIAQENVPMAALYEPDYESLETRLGSINNDAGLPNSVSQTVENFAELPEGTRFVLDSDTFAVAVSDGVVTSRLDSQTGVIRHTFGGAGTISYNPGEVTRSYIDRVTVRVVYPDSSIDIVTPHSVVEVSDSFYYSVQSIDSQRVRNGQSIKVPMTVIAGDGAIGGVPQGAKVVRDRYGSVEDAELMGATIVIDEKTGELTFTAPEDRTGQMWFAAELIYPDGTYSEVHYLFEVTDKSVQDDSVPFFGSSLSS