Involved in the biosynthesis of the arabinogalactan (AG) region of the mycolylarabinogalactan-peptidoglycan (mAGP) complex, an essential component of the mycobacterial cell wall. Catalyzes the addition of an arabinofuranosyl (Araf) residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol (DPA) on the C-3 of an alpha-(1->5)-linked Araf from the arabinan backbone of AG.

Belongs to the glycosyltransferase 87 family.

279 amino acids

MLVQSRTLVTAILSCSLVFGTTVNGASVAIAQENVPMAALYEPDYESLETRLGSINNDAGLPNSVSQTVENFAELPEGTRFVLDSDTFAVAVSDGVVTSRLDSQTGVIRHTFGGAGTISYNPGEVTRSYIDRVTVRVVYPDSSIDIVTPHSVVEVSDSFYYSVQSIDSQRVRNGQSIKVPMTVIAGDGAIGGVPQGAKVVRDRYGSVEDAELMGATIVIDEKTGELTFTAPEDRTGQMWFAAELIYPDGTYSEVHYLFEVTDKSVQDDSVPFFGSSLSS

30 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aftC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here