accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

182 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

19.18 kDa

MPLDFNEIRQLLTTIAQTDIAEVTLKSDDFELTVRKAVGVNNSVVPVVTAPLSGVVGSGLPSAIPIVAHAAPSPSPEPGTSRAADHAVTSSGSQPGAKIIDQKLAEVASPMVGTFYRAPAPGEAVFVEVGDRIRQGQTVCIIEAMKLMNEIEADVSGQVIEILVQNGEPVEYNQPLMRIKPD

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

167 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

18.461 kDa

MDLKQIEKLMIAMGRNGMKRFAIKREGLELELERDTREGNRQEPVFYDSRLFSGFSQERPIPTDPKKDTIKETTTENSETSTTTSSGDFISSPLVGTFYGSPAPDSPSFVKPGDIVSEDTIVCIVEAMKVMNEVKAGMSGRVLEVLITNGDPVQFGSKLFRIAKDAS

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

164 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

18.198 kDa

MDLKQIEKLMIAMGRNKMKRIVIKREGLELELERDTVPSIQEPVFYDNRLFAGFSQERPIPTDQNLGNPIVKESIEKKESEAPAQGDFIVSPLVGTFYGSPSPEAPAFIKPGDTVSEDTVVCIVEAMKVMNEVKAGMSGRVEEILITNGDPVQFGSKLFRIVKA

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

163 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

18.084 kDa

MDLKQIEKLMIAMGRNKMKRIAIKRDGFELELERDTGPNIQEPVFYDNRLFAGFTQERPIPSDQNLGNPIVKEVGEKKEDKPVEGDFIVSPLVGTFYGAPSPESPAFVKPGDIVSEDTVVCIVEAMKVMNEVKAGMAGRVEEVLITNGDPVQFGSKLFRIVKA

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

159 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA (By similarity). Binds biotin (PubMed:7592499).

17.229 kDa

MLNIKEIHELIKAIDESTIDEFVYENEGVSLKLKKHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHKITSPMVGTFYASSSPEAGPYVTAGSKVNENTVVCIVEAMKLFNEIEAEVKGEIVEVLVENGQLVEYGQPLFLVKAE

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

157 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

17.519 kDa

MQITIKDLQDLLSSVQRKKIQTLKLKKNKFELILNKPSKKVPQEVVSLKSSHIFKSIHSETINIPPKKTESINSKPSTNYATIVSPMVGTFYHSPAPGEKIFVQVGDIVKCNQTVCIIEAMKLMNEIEAEIEGIIIEILVKNGDIVDCGQALMKVET

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

156 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

16.687 kDa

MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

156 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

16.687 kDa

MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

156 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

16.687 kDa

MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

155 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

16.247 kDa

MDIRKIKKLIELVEESGITELEVQEEEGTVRISRAAPVIAPAAVQYAAAPVVAPTPAAAPAQVPAAATTAPAASDELSGHLVRSPMVGTFYRSPSPEAKAFVEVGQSVKVGDALCIVEAMKMMNRIEADKAGVVKAILINDGNAVEFDEPLIVIE

accB

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

152 amino acids

This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.

17.049 kDa

MLHSSIYWKNLINTFESGCFSIAEVKFIFSNIHIYKNICNPYKNYQLPELARNLQSSKKLDNAILKQDKKNIIDILSPISGIFYSSSKPGASPFVAVGSVVSKGQTLCIIEAMKTMNEIESDSIGKIHQICARNGDFVTKNQVLMKIILEQS