Protein expression services for accB | Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Description
This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Length
182 amino acids
Sequence
MPLDFNEIRQLLTTIAQTDIAEVTLKSDDFELTVRKAVGVNNSVVPVVTAPLSGVVGSGLPSAIPIVAHAAPSPSPEPGTSRAADHAVTSSGSQPGAKIIDQKLAEVASPMVGTFYRAPAPGEAVFVEVGDRIRQGQTVCIIEAMKLMNEIEADVSGQVIEILVQNGEPVEYNQPLMRIKPD
Mass
19.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make accB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here