Znf365

Protein ZNF365

408 amino acids

Contributes to genomic stability by preventing telomere dysfunction (PubMed:23776040). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis (PubMed:23912123). Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth (PubMed:24481677). Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (PubMed:25983680). Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth. Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery (By similarity).

46.86 kDa

MQQTTFEESRYHWQDSLENVAVCLPFRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLLPSLKDTELLRSSELPKQGKVLRGHAKVTKQKSSYVNLYSISHGHSKDTKPFEMVAERPVSYVQTYTAVDIRADSLDAPCASPGLPTQDTKAAFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFAQLTQKKQEVQRRERALNKQVDVAVEMIAVLKQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFSCDTSEHMLTDIPSNRKPRCLSRGHQHSVCNHPEMRAHFHLKGRSYLKKAKDERAGMQPAKAIHEPAESPREFFRPAKKGEHLGLSRKGNFRPKMAKKKPTAIVNII

Znf365

Protein ZNF365

408 amino acids

Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth (PubMed:24481677). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (By similarity). Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth. Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery. Contributes to genomic stability by preventing telomere dysfunction (By similarity).

46.968 kDa

MQQTTFEESRYRWQDSLENVAVCLPFRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLLPSLKDTDLLRSSELPKQGKLLRGHAKVTKQKPSYVNLYSISHGHSKDPKPFEMVAERPVSYVQTYTAVDIRADSLDAPRSSSGLPTQDTKAAFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALHKQVDVAVEMIAVLKQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFSHDTSEHMLTDISSSRKSRCLSRGHQHSVCNHPELKAHFHLKGRSYLKKAKDERAGMQPAKAIHEQAESPREFFRPAKKGEHLGLSRKGNFRPKMAKKKPTAIVNII

ZNF365

Protein ZNF365

407 amino acids

Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth (PubMed:17389905). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth. Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (By similarity). Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery (PubMed:23966166). Contributes to genomic stability by preventing telomere dysfunction (PubMed:23776040).

46.542 kDa

MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII

ZNF365

Protein ZNF365

407 amino acids

Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth (By similarity). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth. Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (By similarity). Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery. Contributes to genomic stability by preventing telomere dysfunction (By similarity).

46.506 kDa

MQQKAFEESRYPWQESFENVAVCLPFRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVSYVQTYTAMDLRADSLDGPRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLVQRVELAEKQLEYYQSQQASGFGHDLSGHVLTDISSNRKPKCLSRGHPHSVCNHSDLKAHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII

ZNF365

Talanin

216 amino acids

May play a role in uric acid excretion.

24.036 kDa

MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPLMKQAPPWKDHLTFQPLHPAERKTQVWRWQSGNSSDLETTSSASPWPTGSNRDVVLNTLAESCCGLSELITAPPYAGVSIQGFSQIWVLFPFCGGTFHHNEKDVLGLQDFERESVSTSQSRNISLLTLGQLQNCVIGKLTIIDLLTEHLLGVRHGVICFPWGLPSSS