Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth (PubMed:24481677). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (By similarity). Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth. Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery. Contributes to genomic stability by preventing telomere dysfunction (By similarity).

408 amino acids

MQQTTFEESRYRWQDSLENVAVCLPFRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLLPSLKDTDLLRSSELPKQGKLLRGHAKVTKQKPSYVNLYSISHGHSKDPKPFEMVAERPVSYVQTYTAVDIRADSLDAPRSSSGLPTQDTKAAFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALHKQVDVAVEMIAVLKQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFSHDTSEHMLTDISSSRKSRCLSRGHQHSVCNHPELKAHFHLKGRSYLKKAKDERAGMQPAKAIHEQAESPREFFRPAKKGEHLGLSRKGNFRPKMAKKKPTAIVNII

47 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Znf365 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here