UL11

Protein UL11

275 amino acids

Plays a role in the modulation of host immune response by modulating T-cell function. Interacts with host PTPRC/CD45 and thereby reduces host TCR signaling and T-cell proliferation.

Belongs to the RL11 family.

31.381 kDa

MLLRYITFHREKVLYLAIACFFGIYISFHDACILVPAKVGTNVTLNAVHVHDGDYVYWSFGGGGANRLMCRYTPRLDEIHKNTNRSFSCLTNHSLLLINVTEEYTDYYRTMTTFVHQSHNWHNHGNKWTLDTCYYVYVTQNGTLPTTTTKKPTTTTRTTTTTTTKKTTTTSTTTTTTTTKKTTTSTTHHRHSNPKESTTPKTHVELHVGLGATAAETPLQPSPQYQHVATHALWVLAVVIVIIIIIIFYFRIPQKLWLLWQHDKHGIVLIPQTDL

UL11

Protein UL11

272 amino acids

Plays a role in the modulation of host immune response by modulating T-cell function. Interacts with host PTPRC/CD45 and thereby reduces host TCR signaling and T-cell proliferation.

Belongs to the RL11 family.

30.881 kDa

MLFRYITFHREKVLYLTAACIFGVYISLHDACIPVVGKIGTNVTLNAVDVLPPRDQVRWSYGPGGQGYMLCIFTGTSTTTFNNTRFNFSCLSNYSLLLINVTTQYSTTYRTMTSLDHWLHQRHNHGSRWTLDTCYNLTVNENGTFPTTTTKKPTTTTRTTTTTTQRTTTTRTTTTAKKTTISTTHHKHPSPKKSTTPNSHVEHHVGFEATAAETPLQPSPQHQHLATHALWVLAVVIVIIIIIIFYFRIPQKLWLLWQHDKHGIVLIPQTDL

UL11

Cytoplasmic envelopment protein 3

96 amino acids

Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery.

Belongs to the herpesviridae cytoplasmic envelopment protein 3 family.

10.487 kDa

MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEGNFYVPPDMRGVTRAPGRQRLRSSDPPSRHTHRRTPGGACPATQFPPPMSDSE

UL11

Cytoplasmic envelopment protein 3

96 amino acids

Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery.

Belongs to the herpesviridae cytoplasmic envelopment protein 3 family.

10.529 kDa

MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEGNFYVPPDMRVVTRAPGRQRLRSSDPPSRHTHRRTPGGACPATQFPPPMSDSE

UL11

Cytoplasmic envelopment protein 3

96 amino acids

Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery.

Belongs to the herpesviridae cytoplasmic envelopment protein 3 family.

10.556 kDa

MGLAFSGARPCCCRHNVITTDGGEVVSLTAHEFDVVDIESEEEGNFYVPPDVRVVTRAPGPQYRRPSDPPSRHTRRRDPDVARPPATLTPPLSDSE

UL11

Tegument protein UL11

47 amino acids

Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery.

Belongs to the herpesviridae HHV-1 UL11 family.

5.252 kDa

MGESFDAFSLDEDMPMETNEKRKDGRDRGTRAQSAVVVQPVAASRHK