Plays a role in the modulation of host immune response by modulating T-cell function. Interacts with host PTPRC/CD45 and thereby reduces host TCR signaling and T-cell proliferation.

Belongs to the RL11 family.

275 amino acids

MLLRYITFHREKVLYLAIACFFGIYISFHDACILVPAKVGTNVTLNAVHVHDGDYVYWSFGGGGANRLMCRYTPRLDEIHKNTNRSFSCLTNHSLLLINVTEEYTDYYRTMTTFVHQSHNWHNHGNKWTLDTCYYVYVTQNGTLPTTTTKKPTTTTRTTTTTTTKKTTTTSTTTTTTTTKKTTTSTTHHRHSNPKESTTPKTHVELHVGLGATAAETPLQPSPQYQHVATHALWVLAVVIVIIIIIIFYFRIPQKLWLLWQHDKHGIVLIPQTDL

31.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make UL11 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here