UBXN1

UBX domain-containing protein 1

297 amino acids

Ubiquitin-binding protein that interacts with the BRCA1-BARD1 heterodimer, and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1, leads to inhibit the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol (By similarity).

33.402 kDa

MAELTALESLIEMGFPKGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLATPLGHVLGREPTPSEQGGPKGPGSAVGEGKPVLTEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELTAARQRLQEDEMRRAAEERRREKAEELEARQRVREKIERDKAERAKKYGGNVGSQPSPPATEPGPVPSSPSREPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGAQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPG

UBXN1

UBX domain-containing protein 1

297 amino acids

Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In turn, interferes with MAVS oligomerization, and disrupts the MAVS/TRAF3/TRAF6 signalosome. This function probably serves as a brake to prevent excessive RLR signaling (PubMed:23545497). Interferes with the TNFalpha-triggered NF-kappa-B pathway by interacting with cellular inhibitors of apoptosis proteins (cIAPs) and thereby inhibiting their recruitment to TNFR1 (PubMed:25681446). Prevents also the activation of NF-kappa-B by associating with CUL1 and thus inhibiting NF-kappa-B inhibitor alpha/NFKBIA degradation that remains bound to NF-kappa-B (PubMed:28152074). Interacts with the BRCA1-BARD1 heterodimer and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1 leads to the inhibition of the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer (PubMed:20351172). Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.

33.325 kDa

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS

Ubxn1

UBX domain-containing protein 1

297 amino acids

Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In turn, interferes with MAVS oligomerization, and disrupts the MAVS/TRAF3/TRAF6 signalosome. This function probably serves as a brake to prevent excessive RLR signaling. Interferes with the TNFalpha-triggered NF-kappa-B pathway by interacting with cellular inhibitors of apoptosis proteins (cIAPs) and thereby inhibiting their recruitment to TNFR1. Prevents also the activation of NF-kappa-B by associating with CUL1 and thus inhibiting NF-kappa-B inhibitor alpha/NFKBIA degradation that remains bound to NF-kappa-B. Interacts with the BRCA1-BARD1 heterodimer and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1 leads to the inhibition of the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.

33.573 kDa

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLSHVLGREPTPSEQVGPEGSGSAAGESRPILTEEERQEQTKRMLELVAQKQREREEREEREALEREKQRRRQGQELSVARQKLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSRSSPPATDPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEEPGQDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS

Ubxn1

UBX domain-containing protein 1

297 amino acids

Ubiquitin-binding protein that interacts with the BRCA1-BARD1 heterodimer, and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1, leads to inhibit the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol (By similarity).

33.582 kDa

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLSHILGREPTPSEQVGPEGSGSAAGESKPVLTEEERQEQTKRMLELVAQKQREREEREEREALEREKQRRRQGQELSAARQKLQEDEIRRAAEERRREKAEELAARQRVREKIERDKAERAQKYGGTVGSRSSPPATDPGPVPSSPRQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEEPGQDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS

ubxn1

UBX domain-containing protein 1

294 amino acids

Ubiquitin-binding protein that specifically binds 'Lys-6'-linked polyubiquitin chains. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol. Involved in ubiquitin-proteasome systems (By similarity).

33.436 kDa

MADCTTLDSLLEMGFGRNRAEKAVAHTGNQGIERAMDWLMEHENDPDIDEPYVPPAGNTLGPAEEQSQSPTEIPESIEDTEEGNARQPMTEEERKEQVKRLEDLMKARQEERRERERQEGIEREKQRRKQGQELLQVRQKLQEDEMKKLADQRRKEKMEDRLAKQRVKDKIARDREERAQKFGGGSSSTGLSSPPAEAPALSPPENQGAPPAKKDYDDCRIQVRLLDGTTLSTVFKAQEPLAAVRVYVQMNGANGQDFNLITPYPRRVYTDLDMEKPLRELGLVPSAVLVVTKK

ubxn1

UBX domain-containing protein 1

287 amino acids

Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol. Involved in ubiquitin-proteasome systems (By similarity).

32.566 kDa

MAECSTLESLIEMGFSPSRAEKALAATGNQGIEPAMDWLVEHEDDPDIDEPSVVVPEDSDSGTTDTQGMDTCEERLPLTEEEKEKQTKRMMELIAQKQKEREEREKRERIEQEKQRRKQGQELSAVKQKIQEQEMQKAVEDRRREKQEEKLARDRVREKIARDKAERARRFGGAGSEPISPPAEASIPATTPSPSSPVQEPPTKKEYDQCRIQVRLLDGSALSQTFRAREQLAAVRLYVELNWPGGAPGPFNLLTSFPRRVFTEEDMEKPLQELGLVPSAVLIVARK