Ubiquitin-binding protein that specifically binds 'Lys-6'-linked polyubiquitin chains. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol. Involved in ubiquitin-proteasome systems (By similarity).

294 amino acids

MADCTTLDSLLEMGFGRNRAEKAVAHTGNQGIERAMDWLMEHENDPDIDEPYVPPAGNTLGPAEEQSQSPTEIPESIEDTEEGNARQPMTEEERKEQVKRLEDLMKARQEERRERERQEGIEREKQRRKQGQELLQVRQKLQEDEMKKLADQRRKEKMEDRLAKQRVKDKIARDREERAQKFGGGSSSTGLSSPPAEAPALSPPENQGAPPAKKDYDDCRIQVRLLDGTTLSTVFKAQEPLAAVRVYVQMNGANGQDFNLITPYPRRVYTDLDMEKPLRELGLVPSAVLVVTKK

33.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ubxn1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here