tipin

TIMELESS-interacting protein

360 amino acids

Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be required fin the replication checkpoint induced by hydroxyurea or ultraviolet light (By similarity).

Belongs to the CSM3 family.

40.337 kDa

MMDPLDNGLFDLPDYEHTEDENFPPLPPPHSPGADDEAEDVANGDDWTENAGQTQREEAPKPARRVVKRPQPKLDGQRLASQRGLPALRHMFDDVKFKGKGHETEDLKILLRQMENWAHRLFPKLQFEDFLNRLESMGNKKEVQTCLKKIRMDLPIVHDDFLSEEVVVQTEDHAIDMPSEDFSFPDELHVPSPSQPVKVDLSEETLQRIERNRRLALERRMEKMQAQAESQALSQATQSDPNEIPDDAFDAEMLDAVESMTGIPTASQSPPHVDKDLSLVLHSHDLPVQDVSQSPAPCPKPQGDAPPEKALSLVHSALPSTSDPTSPRKPLTEQLPDDADTSSATPYTEAPACTNTKEEY

TIPIN

TIMELESS-interacting protein

301 amino acids

Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress.

Belongs to the CSM3 family.

34.555 kDa

MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEAR

tipin

TIMELESS-interacting protein

294 amino acids

Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be required fin the replication checkpoint induced by hydroxyurea or ultraviolet light (By similarity).

Belongs to the CSM3 family.

33.181 kDa

MIDPLENGLFDIPDYEQIEDETFPPLPPPLSPGRAELEDDLFGNAEGEEEGEVSKLAEVPVAKRRTVKRPRPKLDANRLISEKGLPALRTLFEDVKFKGKGHETENLKLLMLKMENWAHRLYPKMQFEEFIDKVENLGGKKEVQTCLKRIRLDMPITHEDYVAEEAEIQVPEESVPSGDGGFPEDPFIHSTPAPASLTEEQQQRIELNKRLALERRLAKQKQLESTPISIQEDADEPSTSSSGQFLSEENPKTTSNQTPLKHKPAELQESPLHDNESSSHIANGIIDDDDDDDD

TIPIN

TIMELESS-interacting protein

290 amino acids

Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress (By similarity).

Belongs to the CSM3 family.

32.743 kDa

MLEPQENGLTDLPDYEHIEDETFPPFPPPASPGREDGEGAEPEEESGRGAPVPVPPKRTVKRNIPKLNAERLISERGLPALRHVFEKAKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVECLGNKKEVQTCLKRIRLDLPILHEDFVSNNDEVEENNGHDVTATELDHFLTNSYGSVEFASESSRSLTEEEQQRIERNKQLALERRQAKLLSNSQSLGNDLSVNTPSTQTSEAGSTGEEQKEEESNGFNKDLLDSPHNAGAASTVNEEEQLKVEETQLDQSF

TIPIN

TIMELESS-interacting protein

283 amino acids

Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be required fin the replication checkpoint induced by hydroxyurea or ultraviolet light (By similarity).

Belongs to the CSM3 family.

31.827 kDa

MAMIDPLENNLFDLPDYENTEDETFPPLPPPTSPGRGDAEWAQANGDPDGNQQSETKDSSSAARKAVKRSIPKLDANRLVSERGLPALRHMFDNVKFKGKGHEAEDLKTLLRHMEHWAHRLFPKLQFDDFIDRVESLGNKKEVQTCLKRIRLDLPILHEDFTANEGGGGESNGLDMATEEVHSFSGNVGELDSLPGTTLTEEQQQRIKRNRQLALERRQAKMQCNSQSQHDELSPSYPEEELNIPVARDLTGALEDTQVTATNVAVTETEDRERELQCASEKQ

Tipin

TIMELESS-interacting protein

278 amino acids

Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress.

Belongs to the CSM3 family.

31.498 kDa

MLEQEENGLFEIPDYEHVEDETFPPFPPPASPERDPADAEPEEGSGSGVPVPPKRTVKRNLPKLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLGNKKEVQTCLKRIRLDLPIVHEDFVNNNDEVGEANGPDVSATGFDPFLTSSSDSRKFASEPTRSLTEEQQQRIERNKQLALERRQAKLLSNSQSLENDVTVEENSTGEDQEESNGLNIDTADGPHDVPFASTHEEEQCKAEETQLDHTNLD

Tipin

TIMELESS-interacting protein

276 amino acids

Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress.

Belongs to the CSM3 family.

31.137 kDa

MLEQEENGLFEIPDYEHVEDETFPPFPPPGSPERDPAEAEPDEGSGAPVPVPPKRIVKRNIPKLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLGNKKEVQTCLKRIRLDLPIVHEDFVNNNDEVEETNSLDAAATGFDAFVTSSSDSKRFASEASRNLTEEQQQRIEKNKQLALERRQAKLLSNSQSLENDVTVEESSTGENQEESNGLISADGPHDVPSASTQEEGQLEAEETQLDHPNLD