Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress.

Belongs to the CSM3 family.

276 amino acids

MLEQEENGLFEIPDYEHVEDETFPPFPPPGSPERDPAEAEPDEGSGAPVPVPPKRIVKRNIPKLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLGNKKEVQTCLKRIRLDLPIVHEDFVNNNDEVEETNSLDAAATGFDAFVTSSSDSKRFASEASRNLTEEQQQRIEKNKQLALERRQAKLLSNSQSLENDVTVEESSTGENQEESNGLISADGPHDVPSASTQEEGQLEAEETQLDHPNLD

31.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Tipin using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here