tyw5

tRNA wybutosine-synthesizing protein 5

326 amino acids

tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes (By similarity).

Belongs to the TYW5 family.

38.059 kDa

MDCQEKLEVPVYTDVDKETFLRDIYPQRRPAVLKRVPIGPCVRTWTVCFLAEKGGDREVKVHVSPEPRMDFLHKNFVYRTLPFDEFIKRAAEAKHPEFFISEDESYYLRSLGEDARKEPADLRKQFPELAEDFHVPQFFEPEQFFSSVFRISSPGLQLWTHYDVMDNLLAQVTGKKRVVLYSPEDALHLYLTGDKSEVLDIDSPDLQLYPEFVKARRYECILEPGDLLFIPALWFHNTLALQFGVGVNVFWRHLPSESYDKKDPYGNKDPVAATRALQSLERTLGILDELPPDYRDFYARRMVLRIQSRAYIRKPINAAQENSDTT

TYW5

tRNA wybutosine-synthesizing protein 5

318 amino acids

tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes (By similarity).

Belongs to the TYW5 family.

37.244 kDa

MEQREQPAVQVPSLDGVTRERFLRDVYPRREPVVLKGMELGPCTTKWTVDYLSQAAGSKEVKIHVSAVPQMDFLSKNFVYRTLPFDVFVRRAAEVKHKDYFLSEDEKYYLRSVGEDVRKDIADIRKQFPVLAEDVQIPEYFEKEQFFSSVFRISSAGLQLWTHYDVMDNFLIQVTGRKRVVLYSPRDVPYLYLSGTKSEVLDVDNPDFEKYPLFAKAKRYQCYLEAGDVLFIPAMWFHNVISEEFGVALNVFWKHLPAECYDKSDTYGNKDPTAASRAIQILDRALKTLEELPEEYRDFYARRMVLRIQEKAYRNDNG

TYW5

tRNA wybutosine-synthesizing protein 5

315 amino acids

tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes.

Belongs to the TYW5 family.

36.548 kDa

MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE

Tyw5

tRNA wybutosine-synthesizing protein 5

315 amino acids

tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes (By similarity).

Belongs to the TYW5 family.

36.633 kDa

MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVPQMDFISKNFVYRTLPFNKLVQRAAEETHKEFFISEDEKYYLRSLGEDPRKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYDTTDTYGNKDPVAASRAVQILDRALKTLAELPEEYRDFYARQMVLRIQDKAYSKNFE