tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes (By similarity).

Belongs to the TYW5 family.

315 amino acids

MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVPQMDFISKNFVYRTLPFNKLVQRAAEETHKEFFISEDEKYYLRSLGEDPRKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYDTTDTYGNKDPVAASRAVQILDRALKTLAELPEEYRDFYARQMVLRIQDKAYSKNFE

36.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Tyw5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here