TMT-3

Botryococcene C-methyltransferase

379 amino acids

Converts botryococcene to mono- and dimethyl derivatives, but not to tri- and tetramethylated products. Unable to methylate cycloartenol, zymosterol or lanosterol, but can also use squalene as substrate. Methylates both C-3 and C22 positions, but only C-3 position in monomethylated squalenes. In contrast, monomethylated botryococcene occured mainly at the C-20 position yielding showacene, but also at the C-3 position yielding isoshowacene.

Belongs to the class I-like SAM-binding methyltransferase superfamily. Erg6/SMT family.

41.783 kDa

MALDLLSSYAPGLVESLLTWKGAAGLAAAVALGYIIISNLPGRQVAKPSLLQVRTGGVAFEKVAEVVADYSDSYGQTEKGELIVKDNNKIVSLANTFYDLITDGYEWGWGSGFHFSHRLPGMSFNASQLLHESRMASFLRLKPGMQVLDVGCGVGNPGRTVAACSGAVVTGITINAYQIKRAELHTKRAGLVGYFKPVQGNFCAMPFQDKSFDAAFAMDSTCHAPKLEDVYSEVFRVLKPGAYFATYEWVSTKNYDSNNPEHVKCMNSIILGNGLPNIRSWKQAEEAGKNVGFNLLTSLDMATNSPIGKPWYSVPERMVNWGLFRFHKACIRTASTLHLLPPESWKFFYILAEMAENLVKGGQWDIFTPMHLLIFQKPE