Converts botryococcene to mono- and dimethyl derivatives, but not to tri- and tetramethylated products. Unable to methylate cycloartenol, zymosterol or lanosterol, but can also use squalene as substrate. Methylates both C-3 and C22 positions, but only C-3 position in monomethylated squalenes. In contrast, monomethylated botryococcene occured mainly at the C-20 position yielding showacene, but also at the C-3 position yielding isoshowacene.

Belongs to the class I-like SAM-binding methyltransferase superfamily. Erg6/SMT family.

379 amino acids

MALDLLSSYAPGLVESLLTWKGAAGLAAAVALGYIIISNLPGRQVAKPSLLQVRTGGVAFEKVAEVVADYSDSYGQTEKGELIVKDNNKIVSLANTFYDLITDGYEWGWGSGFHFSHRLPGMSFNASQLLHESRMASFLRLKPGMQVLDVGCGVGNPGRTVAACSGAVVTGITINAYQIKRAELHTKRAGLVGYFKPVQGNFCAMPFQDKSFDAAFAMDSTCHAPKLEDVYSEVFRVLKPGAYFATYEWVSTKNYDSNNPEHVKCMNSIILGNGLPNIRSWKQAEEAGKNVGFNLLTSLDMATNSPIGKPWYSVPERMVNWGLFRFHKACIRTASTLHLLPPESWKFFYILAEMAENLVKGGQWDIFTPMHLLIFQKPE

41.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TMT-3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here