TMEM88

Transmembrane protein 88

159 amino acids

Inhibits the Wnt/beta-catenin signaling pathway. Crucial for heart development and acts downstream of GATA factors in the pre-cardiac mesoderm to specify lineage commitment of cardiomyocyte development (By similarity).

Belongs to the TMEM88 family.

17.187 kDa

MADVPGAQRPVPGGGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLALVLGTILLPAVTMLGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLADCLVPYSRALYRRRRNPQPRPARSSPGPQVAPTSGKVWV

TMEM88

Transmembrane protein 88

159 amino acids

Inhibits the Wnt/beta-catenin signaling pathway. Crucial for heart development and acts downstream of GATA factors in the pre-cardiac mesoderm to specify lineage commitment of cardiomyocyte development.

Belongs to the TMEM88 family.

17.251 kDa

MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTMLGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLADCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV

Tmem88

Transmembrane protein 88

159 amino acids

Inhibits the Wnt/beta-catenin signaling pathway. Crucial for heart development and acts downstream of GATA factors in the pre-cardiac mesoderm to specify lineage commitment of cardiomyocyte development (By similarity).

Belongs to the TMEM88 family.

17.358 kDa

MAEVPGAQRPVLAGGPEPRDPLDCWACAVLVTAQNLLVAVFNLLLLALVLGTILLPAVIMLGFGFLCHSQFLRSQAPLCTSHLRDPGFTALLVTGFLLLVPLLVLALATYRRLCLRLRLADCLVPYSRALYRRRRIPQPKQIPVSPGSRSVPTPGKVWV