Inhibits the Wnt/beta-catenin signaling pathway. Crucial for heart development and acts downstream of GATA factors in the pre-cardiac mesoderm to specify lineage commitment of cardiomyocyte development (By similarity).

Belongs to the TMEM88 family.

159 amino acids

MAEVPGAQRPVLAGGPEPRDPLDCWACAVLVTAQNLLVAVFNLLLLALVLGTILLPAVIMLGFGFLCHSQFLRSQAPLCTSHLRDPGFTALLVTGFLLLVPLLVLALATYRRLCLRLRLADCLVPYSRALYRRRRIPQPKQIPVSPGSRSVPTPGKVWV

17.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Tmem88 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here