TMEM199

Transmembrane protein 199

208 amino acids

Accessory component of the proton-transporting vacuolar (V)-ATPase protein pump involved in intracellular iron homeostasis. In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation (PubMed:28296633). May be involved in Golgi homeostasis (PubMed:26833330).

23.13 kDa

MASSLLAGERLVRALGPGGELEPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLIRDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL

Tmem199

Transmembrane protein 199

208 amino acids

Accessory component of the proton-transporting vacuolar (V)-ATPase protein pump involved in intracellular iron homeostasis. In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation (By similarity). May be involved in Golgi homeostasis (By similarity).

23.099 kDa

MASSLLAGERLVRALGPGGELEREQLPRKLRAQLEAALGKKHAGSDNATGPRRLVSFRLIRDLHQHLRERNSRLYLHELLEGSDIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDAQCGGTLSDLGKQVRSVKALVVTIFNFIITVAAAFVCTYLGSQYVFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL

TMEM199

Transmembrane protein 199

208 amino acids

In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation (By similarity). May be involved in Golgi homeostasis (By similarity).

23.06 kDa

MASSLLAGERLVRALGPGGELEPELLPRKLRAELEAALGKKHTGGDSSSGPQRLVSFRLIRDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL

Tmem199

Transmembrane protein 199

208 amino acids

Accessory component of the proton-transporting vacuolar (V)-ATPase protein pump involved in intracellular iron homeostasis. In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation (By similarity). May be involved in Golgi homeostasis (By similarity).

23.16 kDa

MASSLLAGERLVRALDPGGELEREQLPRKLRAQLEAALGKKHAGSDNATGPRRLVSFRLIRDLHQHLRERNSMLYLHELLEGSEIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDAQCGGTLSDLGKQVRSVKALVITIFNFIVTVAAAFVCTYLGSQYIFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL